1JNN: Fab-Estradiol Complexes

Crystal Structure of Fab-Estradiol Complexes. Determined by X-ray diffraction at 3.2 Å resolution. Released 6 Feb 2002.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,263
Mol. weight: 46.64 kDa
Ligands: EST
Released: 6 Feb 2002

Explore 1JNN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JNN contains 16 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	6
α-helix	6-9	4
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-47	3	8
β-strand	49-50	2	9
β-strand	51	1	8
β-strand	59-60	2	9
α-helix	62-65	4
β-strand	68-72	5	6
α-helix	74-76	3
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-94	3	7
β-strand	95-98	4	8
β-strand	108-112	5	7
α-helix	115-117	3
β-strand	118	1	10
α-helix	119-120	2
β-strand	121-125	5	11
β-strand	136-148	11	11
β-strand	149	1	10
β-strand	154-158	4	12
β-strand	167	1	12
β-strand	172-175	4	11
β-strand	180	1	13
β-strand	185	1	13
β-strand	186-195	10	11
α-helix	200-204	4
β-strand	208-213	6	12
α-helix	214-216	3
β-strand	218-223	6	12

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	33-38	6	2
α-helix	43-44	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	98	1	2
β-strand	102-107	6	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	124-127	4
β-strand	129-137	9	4
β-strand	140	1	3
β-strand	144-149	6	5
β-strand	154-155	2	5
β-strand	159-163	5	4
β-strand	174-182	9	4
α-helix	183-187	5
β-strand	192-198	7	5
α-helix	204	1
β-strand	205-209	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal anti-estradiol 17E12E5 immunoglobulin kappa chain	L	protein	211	Mus musculus	P01837 (AlphaFold model)
Monoclonal anti-estradiol 17E12E5 immunoglobulin gamma-1 chain	H	protein	214	Mus musculus	Q99LC4 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1JNN_1 MONOCLONAL ANTI-ESTRADIOL 17E12E5 IMMUNOGLOBULIN KAPPA CHAIN (chains L)
QIVMTQTPASLSASVGETVTITCRASGNIYNYLAWYQQKQGKSPQLLVYNAKTLVDGVPL
RFSGSGSGTQYSLKINSLQPEDFGNYYCHHFWNTPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (H), FASTA

>1JNN_2 MONOCLONAL ANTI-ESTRADIOL 17E12E5 IMMUNOGLOBULIN GAMMA-1 CHAIN (chains H)
EVQLQQSGAELVKPGASVRLSCSASGFNIKDTYMFWVKQRPEQGLDWIGRINPANGISKY
DPRFQGKATLTADTSSNTAYLQLDNLTSEDTAVYYCAIEKDLPWGQGTLVTVSVAKTTPP
SVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSS
SVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR

Ligands and cofactors

ID	Name	Formula	Copies
EST	Estradiol	C18 H24 O2	1

Primary citation

Highly specific anti-estradiol antibodies: structural characterisation and binding diversity. Monnet, C., Bettsworth, F., Stura, E.A. et al. J Mol Biol (2002) 315:699-712. DOI 10.1006/jmbi.2001.5284 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1JNN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.