1JPL: GGA3 VHS domain
GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose 6-phosphate receptor. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Feb 2002.
- Method
- X-ray diffraction
- Resolution
- 2.4 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 5,655
- Mol. weight
- 84.7 kDa
- Released
- 27 Feb 2002
Explore 1JPL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1JPL contains 48 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 204-1 | 3 | |
| α-helix | 4-17 | 14 | |
| α-helix | 26-38 | 13 | |
| α-helix | 42-54 | 13 | |
| α-helix | 59-75 | 17 | |
| α-helix | 77-84 | 8 | |
| α-helix | 87-97 | 11 | |
| α-helix | 102-105 | 4 | |
| α-helix | 108-124 | 17 | |
| α-helix | 129-140 | 12 | |
| α-helix | 147-149 | 3 | |
Chains B and C: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 205-2 | 3 | |
| α-helix | 4-16 | 13 | |
| α-helix | 26-38 | 13 | |
| α-helix | 42-54 | 13 | |
| α-helix | 59-75 | 17 | |
| α-helix | 77-84 | 8 | |
| α-helix | 87-97 | 11 | |
| α-helix | 103-105 | 3 | |
| α-helix | 108-124 | 17 | |
| α-helix | 129-140 | 12 | |
| α-helix | 147-149 | 3 | |
Chain D: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 204-2 | 4 | |
| α-helix | 4-16 | 13 | |
| α-helix | 26-38 | 13 | |
| α-helix | 42-54 | 13 | |
| α-helix | 59-75 | 17 | |
| α-helix | 77-84 | 8 | |
| α-helix | 87-97 | 11 | |
| α-helix | 103-105 | 3 | |
| α-helix | 108-124 | 17 | |
| α-helix | 129-140 | 12 | |
| α-helix | 147-149 | 3 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 307-309 | 3 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 307-310 | 4 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 308-311 | 4 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 308-310 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| ADP-ribosylation factor binding protein GGA3 | A, B, C, D | protein | 171 | Homo sapiens | Q9NZ52 (AlphaFold model) |
| Cation-Independent Mannose 6-phosphate receptor | E, F, G, H | protein | 12 | | P11717 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>1JPL_1 ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3 (chains A, B, C, D)
GAMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQ
SPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVI
ELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKN
Sequence of entity 2 (E, F, G, H), FASTA
>1JPL_2 Cation-Independent Mannose 6-phosphate receptor (chains E, F, G, H)
FHDDSDEDLLHI
Primary citation
Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains. Misra, S., Puertollano, R., Kato, Y. et al. Nature (2002) 415:933-937. DOI 10.1038/415933a · PubMed
Other PDB entries of the same protein (UniProt Q9NZ52 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1JUQ 2.2 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-dependent Mannose…
- 1P4U 2.2 Å, Crystal structure of GGA3 gae domain in complex with rabaptin-5 peptide
- 1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
- 1WR6 2.6 Å, Crystal structure of GGA3 GAT domain in complex with ubiquitin
- 1YD8 2.8 Å, Complex of human GGA3 gat domain and ubiquitin
Browse structure collections
About this viewer
MolViewer shows 1JPL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.