The Structure of a beta-Catenin Binding Repeat from Adenomatous Polyposis Coli (APC) in Complex with beta-Catenin. Determined by X-ray diffraction at 3.1 Å resolution. Released 16 Jan 2002.
Explore 1JPP in 3D Show helices and sheets RCSB PDB PDBe
1JPP contains 81 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 152-159 | 8 | |
| α-helix | 165-178 | 14 | |
| α-helix | 182-189 | 8 | |
| α-helix | 194-204 | 11 | |
| α-helix | 208-221 | 14 | |
| α-helix | 225-233 | 9 | |
| α-helix | 237-242 | 6 | |
| α-helix | 243-245 | 3 | |
| α-helix | 249-265 | 17 | |
| α-helix | 269-275 | 7 | |
| α-helix | 278-284 | 7 | |
| α-helix | 285-287 | 3 | |
| α-helix | 291-305 | 15 | |
| α-helix | 309-317 | 9 | |
| α-helix | 321-328 | 8 | |
| α-helix | 334-348 | 15 | |
| α-helix | 355-360 | 6 | |
| α-helix | 362-367 | 6 | |
| α-helix | 375-388 | 14 | |
| α-helix | 389-391 | 3 | |
| α-helix | 401-407 | 7 | |
| α-helix | 414-426 | 13 | |
| α-helix | 432-440 | 9 | |
| α-helix | 443-454 | 12 | |
| α-helix | 458-471 | 14 | |
| α-helix | 478-487 | 10 | |
| α-helix | 491-496 | 6 | |
| α-helix | 504-517 | 14 | |
| α-helix | 521-523 | 3 | |
| α-helix | 524-530 | 7 | |
| α-helix | 533-545 | 13 | |
| α-helix | 566-580 | 15 | |
| α-helix | 584-591 | 8 | |
| α-helix | 596-601 | 6 | |
| α-helix | 602-604 | 3 | |
| α-helix | 608-621 | 14 | |
| α-helix | 625-634 | 10 | |
| α-helix | 637-642 | 6 | |
| α-helix | 643-645 | 3 | |
| α-helix | 649-661 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 153-160 | 8 | |
| α-helix | 167-178 | 12 | |
| α-helix | 184-189 | 6 | |
| α-helix | 194-204 | 11 | |
| α-helix | 208-221 | 14 | |
| α-helix | 225-233 | 9 | |
| α-helix | 237-242 | 6 | |
| α-helix | 243-245 | 3 | |
| α-helix | 249-265 | 17 | |
| α-helix | 269-276 | 8 | |
| α-helix | 278-284 | 7 | |
| α-helix | 291-305 | 15 | |
| α-helix | 309-317 | 9 | |
| α-helix | 321-328 | 8 | |
| α-helix | 334-342 | 9 | |
| α-helix | 344-347 | 4 | |
| α-helix | 355-360 | 6 | |
| α-helix | 362-367 | 6 | |
| α-helix | 375-388 | 14 | |
| α-helix | 389-391 | 3 | |
| α-helix | 401-408 | 8 | |
| α-helix | 414-426 | 13 | |
| α-helix | 433-440 | 8 | |
| α-helix | 443-454 | 12 | |
| α-helix | 458-471 | 14 | |
| α-helix | 478-487 | 10 | |
| α-helix | 491-496 | 6 | |
| α-helix | 504-517 | 14 | |
| α-helix | 521-523 | 3 | |
| α-helix | 524-529 | 6 | |
| α-helix | 533-544 | 12 | |
| β-strand | 561 | 1 | 1 |
| β-strand | 564 | 1 | 1 |
| α-helix | 566-580 | 15 | |
| α-helix | 584-591 | 8 | |
| α-helix | 596-601 | 6 | |
| α-helix | 602-604 | 3 | |
| α-helix | 608-621 | 14 | |
| α-helix | 625-634 | 10 | |
| α-helix | 637-642 | 6 | |
| α-helix | 643-645 | 3 | |
| α-helix | 649-661 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1027-1030 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-catenin | A, B | protein | 538 | Mus musculus | Q02248 (AlphaFold model) |
| Adenomatous polyposis coli protein | C, D | protein | 15 | P25054 |
>1JPP_1 BETA-CATENIN (chains A, B) HAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQ MVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLF YAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKL IILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYK NKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPV VVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSM GGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRV AAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYK
>1JPP_2 ADENOMATOUS POLYPOSIS COLI PROTEIN (chains C, D) LDTPINYSLKYSDEQ
Molecular mechanisms of beta-catenin recognition by adenomatous polyposis coli revealed by the structure of an APC-beta-catenin complex. Eklof Spink, K., Fridman, S.G., Weis, W.I. EMBO J (2001) 20:6203-6212. DOI 10.1093/emboj/20.22.6203 · PubMed
Other PDB entries of the same protein (UniProt Q02248 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1JPP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.