1JTH: SNAP25

Crystal structure and biophysical properties of a complex between the N-terminal region of SNAP25 and the SNARE region of syntaxin 1a. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Nov 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 2,057
Mol. weight: 37.26 kDa
Released: 28 Nov 2001

Explore 1JTH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JTH contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	12-71	60

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	192-256	65

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-77	67

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	196-244	49

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SNAP25	A, C	protein	82	Rattus norvegicus	P60881 (AlphaFold model)
syntaxin 1a	B, D	protein	77	Rattus norvegicus	P32851 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1JTH_1 SNAP25 (chains A, C)
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKEAEKNLTDLG

Sequence of entity 2 (B, D), FASTA

>1JTH_2 syntaxin 1a (chains B, D)
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
TKKAVKYQSKARRKKIM

Primary citation

Crystal structure and biophysical properties of a complex between the N-terminal SNARE region of SNAP25 and syntaxin 1a. Misura, K.M., Gonzalez Jr., L.C., May, A.P. et al. J Biol Chem (2001) 276:41301-41309. DOI 10.1074/jbc.M106853200 · PubMed

Other PDB entries of the same protein (UniProt P60881 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1N7S 1.45 Å, High Resolution Structure of a Truncated Neuronal SNARE Complex
5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
1URQ 2.0 Å, Crystal structure of neuronal Q-SNAREs in complex with R-SNARE motif of Tomosyn
6WVW 2.11 Å, Crystal structure of the R59P-SNAP25 containing SNARE complex
1SFC 2.4 Å, Neuronal synaptic fusion complex
5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
5LOW 2.8 Å, Structure of the Ca2+-bound Rabphilin 3A C2B domain SNAP25 complex (P21 space group)
9OJR 2.95 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 3
9OJU 2.97 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 4
9PFF 3.09 Å, Min22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a H3:SNAP-25 SN1), non-hydrolyzing,…
5LOB 3.3 Å, Structure of the Ca2+-bound Rabphilin3A C2B- SNAP25 complex (C2 space group)
9OJZ 3.39 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 5

Browse structure collections

About this viewer

MolViewer shows 1JTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.