1JUN: NMR study of C-jun homodimer

NMR study of C-jun homodimer. Determined by solution NMR. Released 20 Jun 1996.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 680
Mol. weight: 9.77 kDa
Released: 20 Jun 1996

Explore 1JUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JUN contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	276-312	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-jun homodimer	A, B	protein	44	Homo sapiens	P05412 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1JUN_1 C-JUN HOMODIMER (chains A, B)
XCGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY

Primary citation

High resolution NMR solution structure of the leucine zipper domain of the c-Jun homodimer. Junius, F.K., O'Donoghue, S.I., Nilges, M. et al. J Biol Chem (1996) 271:13663-13667. DOI 10.1074/jbc.271.23.13663 · PubMed

Other PDB entries of the same protein (UniProt P05412 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y3V 1.5 Å, 14-3-3 Sigma in complex with phosphorylated c-Jun peptide
5T01 1.89 Å, Human c-Jun DNA binding domain homodimer in complex with methylated DNA
5FV8 1.99 Å, Structure of cJun-FosW coiled coil complex.
1JNM 2.2 Å, Crystal Structure of the Jun/CRE Complex
8SOS 2.33 Å, Human CD1d presenting sphingomyelin C24:1 in complex with VHH nanobody 1D17
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
1T2K 3.0 Å, Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA
1FOS 3.05 Å, Two human C-fos:c-jun:dna complexes
1S9K 3.1 Å, Crystal Structure of Human NFAT1 and Fos-Jun on the IL-2 ARRE1 Site

Browse structure collections

About this viewer

MolViewer shows 1JUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.