1A02: DNA binding domains of nfat, fos and jun

Structure of the DNA binding domains of nfat, fos and jun bound to DNA. Determined by X-ray diffraction at 2.7 Å resolution. Released 27 May 1998.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 5
Atoms: 3,974
Mol. weight: 59.85 kDa
Released: 27 May 1998

Explore 1A02 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A02 contains 7 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	141-191	51

Chain J: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	268-316	49

Chain N: 5 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	410-414	5	1
β-strand	419	1	2
β-strand	423	1	3
β-strand	432	1	3
β-strand	442-445	4	1
β-strand	454-461	8	4
β-strand	470	1	4
β-strand	474-478	5	3
β-strand	490-492	3	4
β-strand	498-503	6	4
β-strand	504	1	1
β-strand	510-512	3	1
β-strand	516-520	5	3
α-helix	523-526	4
β-strand	541-542	2	2
β-strand	543-551	9	4
β-strand	557-563	7	4
α-helix	564-566	3
β-strand	567-568	2	2
α-helix	571-576	6
β-strand	579-583	5	5
β-strand	588-589	2	6
β-strand	595-601	7	5
β-strand	608-614	7	6
β-strand	620-626	7	6
β-strand	628-634	7	5
β-strand	637-641	5	5
α-helix	642-645	4
β-strand	654-662	9	6
β-strand	666-667	2	6
α-helix	668-670	3
β-strand	671-676	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(dtpdtpdgpdgpdapdapdapdapdtpdtpdtpdgpdtpdtpdtpdcpdapdtpdapdg)-3')	A	DNA	20
DNA (5'-d(dapdapdcpdtpdapdtpdgpdapdapdapdcpdapdapdapdtpdtpdtpdtpdcpdc)-3')	B	DNA	20
Nuclear factor of activated T cells	N	protein	301	Homo sapiens	Q13469 (AlphaFold model)
Ap-1 fragment fos	F	protein	56	Homo sapiens	P01100 (AlphaFold model)
Ap-1 fragment jun	J	protein	56	Homo sapiens	P05412 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1A02_1 DNA (5'-D(*DTP*DTP*DGP*DGP*DAP*DAP*DAP*DAP*DTP*DTP*DTP*DGP*DTP*DTP*DTP*DCP*DAP*DTP*DAP*DG)-3') (chains A)
TTGGAAAATTTGTTTCATAG

Sequence of entity 2 (B), FASTA

>1A02_2 DNA (5'-D(*DAP*DAP*DCP*DTP*DAP*DTP*DGP*DAP*DAP*DAP*DCP*DAP*DAP*DAP*DTP*DTP*DTP*DTP*DCP*DC)-3') (chains B)
AACTATGAAACAAATTTTCC

Sequence of entity 3 (N), FASTA

>1A02_3 NUCLEAR FACTOR OF ACTIVATED T CELLS (chains N)
MRGSHHHHHHTDPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPT
GGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTK
VLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRI
VSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTD
GQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHP
V

Sequence of entity 4 (F), FASTA

>1A02_4 AP-1 FRAGMENT FOS (chains F)
MKRRIRRERNKMAAAKSRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKL

Sequence of entity 5 (J), FASTA

>1A02_5 AP-1 FRAGMENT JUN (chains J)
MKAERKRMRNRIAASKSRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQL

Primary citation

Structure of the DNA-binding domains from NFAT, Fos and Jun bound specifically to DNA. Chen, L., Glover, J.N., Hogan, P.G. et al. Nature (1998) 392:42-48. DOI 10.1038/32100 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
8R07 1.74 Å, C-terminal Rel-homology Domain of NFAT1
1P7H 2.6 Å, Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
1OWR 3.0 Å, Crystal structure of human NFAT1 bound monomerically to DNA
2O93 3.05 Å, Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
1PZU 3.1 Å, An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

Browse structure collections

About this viewer

MolViewer shows 1A02 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.