1JUQ: GGA3 VHS domain

GGA3 VHS domain complexed with C-terminal peptide from cation-dependent Mannose 6-phosphate receptor. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Feb 2002.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 8
Atoms: 5,389
Mol. weight: 85.27 kDa
Released: 27 Feb 2002

Explore 1JUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JUQ contains 43 α-helices and 2 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-16	8
α-helix	26-38	13
α-helix	42-54	13
α-helix	59-75	17
α-helix	77-84	8
α-helix	87-97	11
α-helix	99-103	5
α-helix	108-124	17
α-helix	129-140	12
α-helix	147-149	3
β-strand	150	1	1

Chain B: 11 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	205-2	3
α-helix	4-17	14
α-helix	26-38	13
α-helix	42-54	13
α-helix	59-75	17
α-helix	77-84	8
α-helix	87-97	11
α-helix	103-105	3
α-helix	108-124	17
α-helix	129-140	12
α-helix	147-149	3
β-strand	150	1	1

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	9-16	8
α-helix	26-38	13
α-helix	42-54	13
α-helix	59-75	17
α-helix	77-84	8
α-helix	87-97	11
α-helix	103-105	3
α-helix	108-124	17
α-helix	129-140	12
α-helix	147-149	3

Chain D: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	205-2	3
α-helix	4-16	13
α-helix	26-38	13
α-helix	42-54	13
α-helix	59-75	17
α-helix	77-84	8
α-helix	87-97	11
α-helix	103-105	3
α-helix	108-124	17
α-helix	129-140	12
α-helix	147-149	3

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	309-312	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA3	A, B, C, D	protein	171	Homo sapiens	Q9NZ52 (AlphaFold model)
Cation-dependent mannose-6-phosphate receptor	E, F, G, H	protein	13		P20645 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1JUQ_1 ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3 (chains A, B, C, D)
GAMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQ
SPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVI
ELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKN

Sequence of entity 2 (E, F, G, H), FASTA

>1JUQ_2 Cation-dependent mannose-6-phosphate receptor (chains E, F, G, H)
EESEERDDHLLPM

Primary citation

Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains. Misra, S., Puertollano, R., Kato, Y. et al. Nature (2002) 415:933-937. DOI 10.1038/415933a · PubMed

Other PDB entries of the same protein (UniProt Q9NZ52 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4U 2.2 Å, Crystal structure of GGA3 gae domain in complex with rabaptin-5 peptide
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
1WR6 2.6 Å, Crystal structure of GGA3 GAT domain in complex with ubiquitin
1YD8 2.8 Å, Complex of human GGA3 gat domain and ubiquitin

Browse structure collections

About this viewer

MolViewer shows 1JUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.