1JVK: Immunoglobulin lambda light chain

Three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor. Determined by X-ray diffraction at 1.94 Å resolution. Released 3 May 2002.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,418
Mol. weight: 45.22 kDa
Released: 3 May 2002

Explore 1JVK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JVK contains 15 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	5	1	2
β-strand	9-12	4	3
β-strand	17-23	7	2
β-strand	35-40	6	3
β-strand	47-50	4	3
β-strand	51	1	4
β-strand	55	1	4
β-strand	64-69	6	2
β-strand	72-78	7	2
α-helix	82-84	3
β-strand	86-92	7	3
β-strand	101-102	2	3
β-strand	103	1	1
β-strand	106-110	5	3
α-helix	113-115	3
β-strand	116	1	5
α-helix	117-118	2
β-strand	119-123	5	6
α-helix	124-126	3
α-helix	127-131	5
β-strand	135-144	10	6
β-strand	145	1	5
β-strand	150-155	6	7
β-strand	158-159	2	7
α-helix	160	1
β-strand	164-166	3	6
α-helix	167-169	3
β-strand	170-171	2	6
β-strand	177-185	9	6
α-helix	187-191	5
β-strand	196-202	7	7
β-strand	205-211	7	7

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	8
β-strand	9-12	4	9
β-strand	18-23	6	8
β-strand	35-40	6	9
α-helix	45-46	2
β-strand	47-50	4	9
β-strand	51	1	10
β-strand	55	1	10
β-strand	64-69	6	8
β-strand	72-77	6	8
α-helix	82-84	3
β-strand	86-94	9	9
β-strand	99-102	4	9
β-strand	106-110	5	9
β-strand	116	1	11
α-helix	117-118	2
β-strand	119-123	5	12
α-helix	124-126	3
α-helix	127-131	5
β-strand	135-144	10	12
β-strand	145	1	11
β-strand	150-154	5	13
β-strand	159-160	2	13
β-strand	164-166	3	12
α-helix	167-169	3
β-strand	170-171	2	12
β-strand	177-185	9	12
α-helix	187-192	6
β-strand	196-202	7	13
β-strand	205-211	7	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin lambda light chain	A, B	protein	216	Homo sapiens	P0DOY2 (AlphaFold model), Q6PJG0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1JVK_1 IMMUNOGLOBULIN LAMBDA LIGHT CHAIN (chains A, B)
QTALTQPASVSGSPGQSITVSCTGVSSIVGSYNLVSWYQQHPGKAPKLLTYEVNKRPSGV
SDRFSGSKSGNSASLTISGLQAEDEADYYCSSYDGSSTSVVFGGGTKLTVLGQPKAAPSV
TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTKPSKQSNNKYAAS
SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTAC

Primary citation

Three-dimensional structure of an immunoglobulin light-chain dimer with amyloidogenic properties. Bourne, P.C., Ramsland, P.A., Shan, L. et al. Acta Crystallogr D Biol Crystallogr (2002) 58:815-823. DOI 10.1107/S0907444902004183 · PubMed

Other PDB entries of the same protein (UniProt P0DOY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
4LLY 1.6 Å, Crystal structure of Pertuzumab Clambda Fab with variable and constant domain redesigns…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
4LLM 1.75 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
8ECV 1.81 Å, Bovine Fab 2F12
1AQK 1.84 Å, Three-dimensional structure of a human FAB with high affinity for tetanus toxoid
4LLW 1.95 Å, Crystal structure of Pertuzumab Clambda Fab with variable domain redesign (VRD2) at 1.95A
4EOW 1.97 Å, Crystal structure of a disease-associated anti-human GM-CSF autoantibody MB007
7FAB 2.0 Å, Crystal structure of human immunoglobulin fragment FAB new refined at 2.0 Å resolution
8ECQ 2.0 Å, Bovine Fab 2G3

Browse structure collections

About this viewer

MolViewer shows 1JVK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.