Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion. Determined by X-ray diffraction at 3.0 Å resolution. Released 18 Oct 2001.
Explore 1JYF in 3D Show helices and sheets RCSB PDB PDBe
1JYF contains 10 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 63-69 | 7 | 1 |
| α-helix | 74-89 | 16 | |
| β-strand | 93-99 | 7 | 1 |
| α-helix | 104-116 | 13 | |
| β-strand | 122-125 | 4 | 1 |
| α-helix | 130-139 | 10 | |
| β-strand | 145-147 | 3 | 1 |
| β-strand | 158-161 | 4 | 1 |
| α-helix | 163-176 | 14 | |
| β-strand | 182-186 | 5 | 2 |
| α-helix | 192-207 | 16 | |
| β-strand | 214-217 | 4 | 2 |
| α-helix | 222-234 | 13 | |
| β-strand | 241-244 | 4 | 2 |
| α-helix | 247-258 | 12 | |
| β-strand | 264 | 1 | 3 |
| β-strand | 268 | 1 | 3 |
| β-strand | 269-274 | 6 | 2 |
| α-helix | 278-281 | 4 | |
| α-helix | 285-286 | 2 | |
| β-strand | 287-290 | 4 | 2 |
| α-helix | 293-307 | 15 | |
| β-strand | 316-319 | 4 | 1 |
| β-strand | 322-324 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lactose Operon Repressor | A | protein | 349 | Escherichia coli | P03023 (AlphaFold model) |
>1JYF_1 Lactose Operon Repressor (chains A) MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQ SLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVS GLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQ QIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTS VDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQL
Structure of a variant of lac repressor with increased thermostability and decreased affinity for operator. Bell, C.E., Barry, J., Matthews, K.S. et al. J Mol Biol (2001) 313:99-109. DOI 10.1006/jmbi.2001.5041 · PubMed
Other PDB entries of the same protein (UniProt P03023 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1JYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.