Crystal Structure of the Focal Adhesion Targeting Domain of Focal Adhesion Kinase. Determined by X-ray diffraction at 1.95 Å resolution. Released 30 Jan 2002.
Explore 1K04 in 3D Show helices and sheets RCSB PDB PDBe
1K04 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 911-914 | 4 | |
| α-helix | 923-942 | 20 | |
| α-helix | 944-946 | 3 | |
| α-helix | 947-949 | 3 | |
| α-helix | 950-971 | 22 | |
| α-helix | 972-974 | 3 | |
| α-helix | 977-1006 | 30 | |
| α-helix | 1013-1045 | 33 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Focal adhesion kinase 1 | A | protein | 162 | Homo sapiens | Q05397 (AlphaFold model) |
>1K04_1 FOCAL ADHESION KINASE 1 (chains A) LSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEY VPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMT SLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
The structural basis of localization and signaling by the focal adhesion targeting domain. Arold, S.T., Hoellerer, M.K., Noble, M.E. Structure (2002) 10:319-327. DOI 10.1016/S0969-2126(02)00717-7 · PubMed
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1K04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.