Crystal structure of Zn bound human Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase. Determined by X-ray diffraction at 1.94 Å resolution. Released 21 Dec 2022.
Explore 7W8I in 3D Show helices and sheets RCSB PDB PDBe
7W8I contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 926-942 | 17 | |
| α-helix | 950-974 | 25 | |
| α-helix | 975-977 | 3 | |
| α-helix | 980-982 | 3 | |
| α-helix | 983-1009 | 27 | |
| α-helix | 1016-1049 | 34 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Isoform 5 of Focal adhesion kinase 1 | A | protein | 164 | Homo sapiens | Q05397 (AlphaFold model) |
>7W8I_1 Isoform 5 of Focal adhesion kinase 1 (chains A) SSPADSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPE EYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYV MTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Crystal structure of Zn bound human Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase. Momin, A.A., Sandholu, A.S., Arold, S.T. To be published.
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7W8I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.