1K1F: Bcr-Abl Oncoprotein Oligomerization domain

Structure of the Bcr-Abl Oncoprotein Oligomerization domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 6 Feb 2002.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 8
Atoms: 4,778
Mol. weight: 69.68 kDa
Released: 6 Feb 2002

Explore 1K1F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K1F contains 21 α-helices and 1 β-strand across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	19-21	3
α-helix	28-64	37

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
α-helix	28-65	38

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-14	10
α-helix	19-21	3
α-helix	28-66	39

Chain D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	4-14	11
α-helix	19-21	3
α-helix	28-65	38

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-14	8
α-helix	28-66	39

Chain F: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	19-21	3
α-helix	28-63	36

Chain G: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	19-20	2
α-helix	28-64	37

Chain H: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	28-64	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breakpoint cluster region protein	A, B, C, D, E, F, G, H	protein	72	Homo sapiens	P11274 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>1K1F_1 BREAKPOINT CLUSTER REGION PROTEIN (chains A, B, C, D, E, F, G, H)
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERAKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDR

Primary citation

Structure of the Bcr-Abl oncoprotein oligomerization domain. Zhao, X., Ghaffari, S., Lodish, H. et al. Nat Struct Biol (2002) 9:117-120. PubMed

Other PDB entries of the same protein (UniProt P11274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5N7E 1.65 Å, Crystal structure of the Dbl-homology domain of Bcr-Abl in complex with monobody…
5OC7 1.65 Å, Crystal structure of the pleckstrin-homology domain of Bcr-Abl in complex with monobody…
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…
5N6R Solution structure of the Dbl-homology domain of Bcr-Abl

Browse structure collections

About this viewer

MolViewer shows 1K1F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.