5N7E: Dbl-homology domain of Bcr-Abl

Crystal structure of the Dbl-homology domain of Bcr-Abl in complex with monobody Mb(Bcr-DH_4). Determined by X-ray diffraction at 1.65 Å resolution. Released 27 Dec 2017.

Method: X-ray diffraction
Resolution: 1.65 Å
Organisms: synthetic construct, Homo sapiens
Chains: 2
Atoms: 2,602
Mol. weight: 35.02 kDa
Released: 27 Dec 2017

Explore 5N7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5N7E contains 12 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-15	9	1
β-strand	18-24	7	1
α-helix	25-26	2
β-strand	32-39	8	2
β-strand	47-51	5	2
β-strand	57-60	4	1
α-helix	63-64	2
β-strand	68-76	9	2
β-strand	84	1	2
β-strand	89-94	6	2

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	492-521	30
α-helix	524-531	8
α-helix	540-546	7
α-helix	550-569	20
α-helix	578-586	9
α-helix	588-611	24
α-helix	613-618	6
α-helix	639-651	13
α-helix	653-661	9
α-helix	670-687	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mb(Bcr-DH_4)	A	protein	95	synthetic construct
Breakpoint cluster region protein	B	protein	219	Homo sapiens	P11274 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5N7E_1 Mb(Bcr-DH_4) (chains A)
SVSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETGGNSPVQEFEVPGSKSTATI
SGLKPGVDYTITVYAGSYAYEYYWGPSPISINYRT

Sequence of entity 2 (B), FASTA

>5N7E_2 Breakpoint cluster region protein (chains B)
GAMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQI
ETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAME
MAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKH
TPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVK

Primary citation

Structural and functional dissection of the DH and PH domains of oncogenic Bcr-Abl tyrosine kinase. Reckel, S., Gehin, C., Tardivon, D. et al. Nat Commun (2017) 8:2101-2101. DOI 10.1038/s41467-017-02313-6 · PubMed

Other PDB entries of the same protein (UniProt P11274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OC7 1.65 Å, Crystal structure of the pleckstrin-homology domain of Bcr-Abl in complex with monobody…
1K1F 2.2 Å, Structure of the Bcr-Abl Oncoprotein Oligomerization domain
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…
5N6R Solution structure of the Dbl-homology domain of Bcr-Abl

Browse structure collections

About this viewer

MolViewer shows 5N7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.