Solution Structure of the FHA2 Domain of Rad53 Complexed with a Phosphotyrosyl Peptide Derived from Rad9. Determined by solution NMR. Released 5 Dec 2001.
Explore 1K2M in 3D Show helices and sheets RCSB PDB PDBe
1K2M contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 578-582 | 5 | 1 |
| β-strand | 592-594 | 3 | 1 |
| β-strand | 601-604 | 4 | 2 |
| β-strand | 611-612 | 2 | 2 |
| β-strand | 623-630 | 8 | 2 |
| β-strand | 644-651 | 8 | 2 |
| β-strand | 657-659 | 3 | 1 |
| β-strand | 662-664 | 3 | 1 |
| β-strand | 668-672 | 5 | 2 |
| β-strand | 676-679 | 4 | 1 |
| β-strand | 682 | 1 | 3 |
| β-strand | 689 | 1 | 3 |
| β-strand | 692-696 | 5 | 1 |
| α-helix | 716 | 1 | |
| β-strand | 717-718 | 2 | 2 |
| α-helix | 719 | 1 | |
| α-helix | 721-728 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein Kinase SPK1 | A | protein | 158 | Saccharomyces cerevisiae | P22216 (AlphaFold model) |
| DNA repair protein Rad9 | P | protein | 7 | P14737 (AlphaFold model) |
>1K2M_1 Protein Kinase SPK1 (chains A) GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAV GKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGF KVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL
>1K2M_2 DNA repair protein Rad9 (chains P) EDIYYLD
Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes. Byeon, I.J., Yongkiettrakul, S., Tsai, M.D. J Mol Biol (2001) 314:577-588. DOI 10.1006/jmbi.2001.5141 · PubMed
Other PDB entries of the same protein (UniProt P22216 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1K2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.