Solution Structure of a Bcl-2 Homolog from Kaposi's Sarcoma Virus. Determined by solution NMR. Released 10 Apr 2002.
Explore 1K3K in 3D Show helices and sheets RCSB PDB PDBe
1K3K contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-18 | 8 | |
| α-helix | 35-54 | 20 | |
| α-helix | 62-66 | 5 | |
| α-helix | 67-71 | 5 | |
| α-helix | 72-76 | 5 | |
| α-helix | 84-100 | 17 | |
| α-helix | 106-113 | 8 | |
| α-helix | 115-123 | 9 | |
| α-helix | 125-130 | 6 | |
| α-helix | 135-143 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| functional anti-apoptotic factor vBCL-2 homolog | A | protein | 158 | Human herpesvirus 8 | Q76RI8 |
>1K3K_1 functional anti-apoptotic factor vBCL-2 homolog (chains A) MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRF HSTTGIDQLGLSMLQVSGDGNMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPAYAY EAIGPQWFRARGGWRGLKAYCTQVLTDDDDLEHHHHHH
Solution structure of a Bcl-2 homolog from Kaposi sarcoma virus. Huang, Q., Petros, A.M., Virgin, H.W. et al. Proc Natl Acad Sci U S A (2002) 99:3428-3433. DOI 10.1073/pnas.062525799 · PubMed
Other PDB entries of the same protein (UniProt Q76RI8), best resolution first:
MolViewer shows 1K3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.