1K3N: FHA1 Domain of Rad53

NMR Structure of the FHA1 Domain of Rad53 in Complex with a Rad9-derived Phosphothreonine (at T155) Peptide. Determined by solution NMR. Released 5 Dec 2001.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,311
Mol. weight: 18.71 kDa
Released: 5 Dec 2001

Explore 1K3N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K3N contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	16-24	9
α-helix	27	1
β-strand	34-37	4	1
β-strand	46-48	3	1
α-helix	52-57	6
β-strand	62-69	8	2
β-strand	76-77	2	2
β-strand	89-94	6	2
β-strand	99-103	5	2
β-strand	109-111	3	1
β-strand	114-115	2	1
α-helix	116-117	2
β-strand	121-123	3	2
β-strand	129-132	4	1
β-strand	141-147	7	1
α-helix	149-157	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein Kinase SPK1	A	protein	151	Saccharomyces cerevisiae	P22216 (AlphaFold model)
DNA repair protein Rad9	B	protein	13		P14737 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1K3N_1 Protein Kinase SPK1 (chains A)
ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPA
CDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVG
VGVESDILSLVIFINDKFKQCLEQNKVDRIR

Sequence of entity 2 (B), FASTA

>1K3N_2 DNA repair protein Rad9 (chains B)
KKMTFQTPTDPLE

Primary citation

Solution structures of two FHA1-phosphothreonine peptide complexes provide insight into the structural basis of the ligand specificity of FHA1 from yeast Rad53. Yuan, C., Yongkiettrakul, S., Byeon, I.J. et al. J Mol Biol (2001) 314:563-575. DOI 10.1006/jmbi.2001.5140 · PubMed

Other PDB entries of the same protein (UniProt P22216 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G6G 1.6 Å, X-ray structure of the N-terminal fha domain from S. Cerevisiae RAD53P in complex with a…
5T2S 2.4 Å, Structure of the FHA1 domain of Rad53 bound simultaneously to the BRCT domain of Dbf4…
4PDP 2.59 Å, Crystal structure of Rad53 kinase domain and SCD2
6C4U 2.6 Å, Engineered FHA with Myc-pTBD peptide
5T2F 2.66 Å, Structure of the FHA1 domain of Rad53 bound to the BRCT domain of Dbf4
5XZW 2.8 Å, Crystal structure of Rad53 1-466
4PDS 2.9 Å, Crystal structure of Rad53 kinase domain and SCD2 in complex with AMPPNP
2YGV 2.94 Å, Conserved N-terminal domain of the yeast Histone Chaperone Asf1 in complex with the…
5XZV 3.1 Å, Crystal structure of Rad53 1-466 in complex with AMP-PNP
1DMZ A refined NMR structure of a new phophopeptide-binding domain containing the FHA2 of RAD53
1FHQ Refined solution structure of the FHA2 domain of RAD53
1FHR Solution structure of the FHA2 domain of RAD53 complexed with a phosphotyrosyl peptide

Browse structure collections

About this viewer

MolViewer shows 1K3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.