1K5J: Nucleoplasmin-Core

The Crystal Structure of Nucleoplasmin-Core. Determined by X-ray diffraction at 2.3 Å resolution. Released 1 Nov 2001.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Xenopus laevis
Chains: 5
Atoms: 3,627
Mol. weight: 68.76 kDa
Released: 1 Nov 2001

Explore 1K5J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K5J contains 10 α-helices and 59 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	1
β-strand	29-32	4	2
β-strand	44-52	9	1
β-strand	61-67	7	2
β-strand	74-81	8	2
β-strand	82	1	3
β-strand	86	1	3
β-strand	88-90	3	1
β-strand	95-96	2	1
α-helix	97	1
α-helix	99	1
β-strand	100-106	7	2
β-strand	111-118	8	1

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	4
β-strand	29-32	4	5
β-strand	44-52	9	4
β-strand	61-69	9	5
β-strand	72-81	10	5
β-strand	82	1	6
β-strand	86	1	6
β-strand	88-90	3	4
β-strand	95-96	2	4
α-helix	97	1
α-helix	99	1
β-strand	100-106	7	5
β-strand	111-118	8	4

Chain C: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	7
β-strand	29-32	4	8
β-strand	45-52	8	7
β-strand	61-66	6	8
β-strand	75-81	7	8
β-strand	82	1	9
β-strand	86	1	9
β-strand	88-90	3	7
β-strand	95-96	2	7
α-helix	97	1
α-helix	99	1
β-strand	100-106	7	8
β-strand	111-117	7	7

Chain D: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	10
β-strand	24	1	11
β-strand	27	1	11
β-strand	29-32	4	12
β-strand	45-52	8	10
β-strand	61-66	6	12
β-strand	75-81	7	12
β-strand	82	1	13
β-strand	86	1	13
β-strand	88-90	3	10
β-strand	95-96	2	10
α-helix	97	1
α-helix	99	1
β-strand	100-106	7	12
β-strand	111-117	7	10

Chain E: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	16-23	8	14
β-strand	24	1	15
β-strand	27	1	15
β-strand	29-32	4	16
β-strand	44-52	9	14
β-strand	61-66	6	16
β-strand	75-81	7	16
β-strand	82	1	17
β-strand	86	1	17
β-strand	88-90	3	14
β-strand	95-96	2	14
α-helix	97	1
α-helix	99	1
β-strand	100-106	7	16
β-strand	111-118	8	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoplasmin Core	A, B, C, D, E	protein	124	Xenopus laevis	P05221 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>1K5J_1 Nucleoplasmin Core (chains A, B, C, D, E)
MASTVSNTSKLEKPVSLIWGCELNEQNKTFEFKVEDDEEKCEHQLALRTVCLGDKAKDEF
HIVEIVTQEEGAEKSVPIATLKPSILPMATMVGIELTPPVTFRLKAGSGPLYISGQHVAM
EEDY

Primary citation

The crystal structure of nucleoplasmin-core: implications for histone binding and nucleosome assembly. Dutta, S., Akey, I.V., Dingwall, C. et al. Mol Cell (2001) 8:841-853. DOI 10.1016/S1097-2765(01)00354-9 · PubMed

Other PDB entries of the same protein (UniProt P05221 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UL1 1.9 Å, Mouse importin alpha: nucleoplasmin cNLS peptide complex
4BPL 2.3 Å, rice importin_alpha in complex with nucleoplasmin NLS
1EE5 2.4 Å, Yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide
2VTX 2.5 Å, Activation of nucleoplasmin, an oligomeric histone chaperone, challenges its stability
1EJY 2.9 Å, Mouse importin alpha-nucleoplasmin nls peptide complex
8VHI 5.0 Å, NPM2-H1.8 isolated from Xenopus egg extract
8VHK 5.16 Å, NPM2-H1.8 isolated from Xenopus egg extract (Stretched form)
8VHJ 5.9 Å, NPM2-H1.8 isolated from Xenopus egg extract (Bent form)

Browse structure collections

About this viewer

MolViewer shows 1K5J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.