1K9K: Calcium bound human S100A6

Crystal structure of calcium bound human S100A6. Determined by X-ray diffraction at 1.76 Å resolution. Released 10 Apr 2002.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,577
Mol. weight: 20.7 kDa
Ligands: CA
Released: 10 Apr 2002

Explore 1K9K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K9K contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-20	17
β-strand	28-29	2	1
α-helix	31-41	11
α-helix	45-47	3
α-helix	50-60	11
β-strand	68-69	2	1
α-helix	70-87	18

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-20	17
β-strand	29	1	2
α-helix	31-41	11
α-helix	45-47	3
α-helix	50-60	11
β-strand	68	1	2
α-helix	70-88	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S100A6	A, B	protein	90	Homo sapiens	P06703 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1K9K_1 S100A6 (chains A, B)
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (BME) are not listed.

Primary citation

Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution. Otterbein, L.R., Kordowska, J., Witte-Hoffmann, C. et al. Structure (2002) 10:557-567. DOI 10.1016/S0969-2126(02)00740-2 · PubMed

Other PDB entries of the same protein (UniProt P06703 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1K8U 1.15 Å, Crystal structure of calcium-free (or apo) human S100A6; CYS3MET mutant…
1K96 1.44 Å, Crystal structure of calcium bound human S100A6
1K9P 1.9 Å, Crystal structure of calcium free (or apo) human S100A6
4YBH 2.4 Å, Crystal structure of the human RAGE ectodomain (VC1C2 fragment) in complex with human…
2M1K Interaction of Human S100A6 (C3S) with V domain of Receptor for Advanced Glycation End…

Browse structure collections

About this viewer

MolViewer shows 1K9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.