1KCS: Antibody PC282

Crystal structure of antibody PC282 in complex with PS1 peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 May 2002.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,348
Mol. weight: 47.33 kDa
Released: 11 May 2002

Explore 1KCS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KCS contains 12 α-helices and 41 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
β-strand	34-40	7	9
β-strand	46-53	8	9
β-strand	58-60	3	9
α-helix	62-64	3
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-100	9	9
β-strand	102-106	5	9
β-strand	110-112	3	9
β-strand	113-114	2	8
α-helix	117-119	3
α-helix	121-122	2
β-strand	123-127	5	10
β-strand	139-148	10	10
β-strand	154-157	4	11
α-helix	158-160	3
β-strand	166-174	9	10
β-strand	177-186	10	10
β-strand	197-202	6	11
α-helix	203-205	3
β-strand	207-212	6	11

Chain L: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	12-14	3	2
β-strand	19-25	7	1
β-strand	33-38	6	3
β-strand	45-49	5	3
β-strand	53-54	2	3
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	3
β-strand	97-98	2	3
β-strand	102-104	3	3
β-strand	105-107	3	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-154	2	6
β-strand	159-163	5	5
β-strand	173-182	10	5
α-helix	183-187	5
β-strand	191-197	7	6
α-helix	204	1
β-strand	205-210	6	6

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PC282 immunoglobulin	L	protein	214	Mus musculus	P01837 (AlphaFold model)
PC282 immunoglobulin	H	protein	217	Mus musculus	P18532 (AlphaFold model)
PS1 peptide	P	protein	15		Q91C35

Sequence of entity 1 (L), FASTA

>1KCS_1 PC282 IMMUNOGLOBULIN (chains L)
DIVMTQSPKSMGMSVGEAVTLNCKASENVGTYVSWYQQKPGQSPVLLIYGASNRYTGVPD
RFTGSGSATDFTLTISSVQADDDADYYCGQSYSSPLTFGGGTKLELKRADAAPTSSIFPP
SSEQLSSGGASVVCFLNSFYPKSIAVKWKVDGSKRANGTANSWTDQDSASSTYSMSSTLT
LTKDKYERHNSYTCEATHKTSSSPVVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1KCS_2 PC282 IMMUNOGLOBULIN (chains H)
QVTLSQSGPGLVKPSQSLSLTCTVTSYSITSDYAWNWIRQFAGQSLEWMGYISYSGSTSY
NPSLKSRISITRDTSKNQFFLQLNSVTTDDTATYYCARGGTGFPYWGTGTNVTVSAASTT
APSVFPLVPGSATAAASAVTLGCLVKGYFPEPVTVAWNEGALSSGVLTVSAVLQSGLYTL
SSNTTVASGTWPSASVTCLVAHPKSSTAADKKIEPKD

Sequence of entity 3 (P), FASTA

>1KCS_3 PS1 peptide (chains P)
HQLDPAFGANSTNPD

Primary citation

Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response. Nair, D.T., Singh, K., Siddiqui, Z. et al. J Immunol (2002) 168:2371-2382. PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1KCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.