1KEF: PDZ1 of SAP90

PDZ1 of SAP90. Determined by solution NMR. Released 6 Mar 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 706
Mol. weight: 10.03 kDa
Released: 6 Mar 2002

Explore 1KEF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KEF contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	16-19	4	1
α-helix	20	1
β-strand	33-38	6	1
α-helix	44-47	4
β-strand	55-56	2	1
α-helix	69-79	11
β-strand	83-87	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
synapse associated protein-90	A	protein	93	Homo sapiens	P78352 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KEF_1 synapse associated protein-90 (chains A)
EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVN
EVDVREVTHSAAVEALKEAGSIVRLYVMRRKPP

Primary citation

The PDZ1 domain of SAP90. Characterization of structure and binding. Piserchio, A., Pellegrini, M., Mehta, S. et al. J Biol Chem (2002) 277:6967-6973. DOI 10.1074/jbc.M109453200 · PubMed

Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TNG 0.95 Å, Crystal Structure of the third PDZ domain of PSD-95 protein E401R mutant
6QJL 1.04 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P21
6QJK 1.05 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
8AH5 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
8AH7 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
3I4W 1.35 Å, Crystal Structure of the third PDZ domain of PSD-95
3K82 1.4 Å, Crystal Structure of the third PDZ domain of PSD-95
9TNF 1.45 Å, Crystal Structure of the third PDZ domain of PSD-95 protein Y397E mutant
8AH4 1.48 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3112 at…
6QJF 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332P mutant: space group…
6QJI 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein: space group P3112
8AH8 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3121 at…

Browse structure collections

About this viewer

MolViewer shows 1KEF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.