9TNF: Third PDZ domain of PSD-95 protein Y397E mutant

Crystal Structure of the third PDZ domain of PSD-95 protein Y397E mutant. Determined by X-ray diffraction at 1.45 Å resolution. Released 13 May 2026.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,839
Mol. weight: 22.23 kDa
Released: 13 May 2026

Explore 9TNF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TNF contains 8 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	312-317	6	1
β-strand	319	1	2
β-strand	322	1	2
β-strand	325-329	5	1
α-helix	331-333	3
β-strand	336-341	6	1
β-strand	342	1	3
α-helix	346-350	5
β-strand	357-362	6	1
β-strand	365-366	2	1
α-helix	372-380	9
β-strand	385-392	8	1
α-helix	394-398	5
β-strand	401	1	4

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	312-317	6	5
β-strand	325-329	5	5
α-helix	331-333	3
β-strand	336-341	6	5
β-strand	342	1	4
α-helix	346-350	5
β-strand	357-362	6	5
β-strand	365-366	2	5
α-helix	372-380	9
β-strand	385-392	8	5
α-helix	394-398	5
β-strand	401	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	A, B	protein	104	Homo sapiens	P78352 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9TNF_1 Disks large homolog 4 (chains A, B)
MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQI
LSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEESRFEAK

Primary citation

Conformational changes on the third PDZ domain of PSD95 upon phosphorylation of Tyr397. Salinas-Garcia, M.C., Murciano-Calles, J., Andujar-Sanchez, M. et al. J Struct Biol (2026) 218:108322-108322. DOI 10.1016/j.jsb.2026.108322 · PubMed

Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TNG 0.95 Å, Crystal Structure of the third PDZ domain of PSD-95 protein E401R mutant
6QJL 1.04 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P21
6QJK 1.05 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
8AH5 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
8AH7 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
3I4W 1.35 Å, Crystal Structure of the third PDZ domain of PSD-95
3K82 1.4 Å, Crystal Structure of the third PDZ domain of PSD-95
8AH4 1.48 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3112 at…
6QJF 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332P mutant: space group…
6QJI 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein: space group P3112
8AH8 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3121 at…
6QJD 1.55 Å, Crystal Structure of the truncated form of the third PDZ domain of PSD-95: residues…

Browse structure collections

About this viewer

MolViewer shows 9TNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.