1KGM: Small serine protease inhibitor sgci

Solution structure of the small serine protease inhibitor sgci. Determined by solution NMR. Released 12 Dec 2001.

Method: Solution NMR
Chains: 1
Atoms: 249
Mol. weight: 3.66 kDa
Released: 12 Dec 2001

Explore 1KGM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KGM contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
β-strand	15-16	2	1
β-strand	19	1	2
β-strand	26	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine protease inhibitor I	A	protein	35		O46162 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KGM_1 SERINE PROTEASE INHIBITOR I (chains A)
EVTCEPGTTFKDKCNTCRCGSDGKSAACTLKACPQ

Primary citation

Comparative structure analysis of proteinase inhibitors from the desert locust, Schistocerca gregaria. Gaspari, Z., Patthy, A., Graf, L. et al. Eur J Biochem (2002) 269:527-537. DOI 10.1046/j.0014-2956.2001.02685.x · PubMed

Other PDB entries of the same protein (UniProt O46162 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XTT 0.93 Å, Bovine trypsin in complex with evolutionary enhanced Schistocerca gregaria protease…
2F91 1.2 Å, 1.2A resolution structure of a crayfish trypsin complexed with a peptide inhibitor, SGTI
3TVJ 1.28 Å, Catalytic fragment of MASP-2 in complex with its specific inhibitor developed by…
4DJZ 3.2 Å, Catalytic fragment of masp-1 in complex with its specific inhibitor developed by…
1KIO Solution structure of the small serine protease inhibitor SGCI[L30R, K31M]
1KJ0 Solution structure of the small serine protease inhibitor sgti

Browse structure collections

About this viewer

MolViewer shows 1KGM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.