Solution structure of the small serine protease inhibitor sgci. Determined by solution NMR. Released 12 Dec 2001.
Explore 1KGM in 3D Show helices and sheets RCSB PDB PDBe
1KGM contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-12 | 2 | 1 |
| β-strand | 15-16 | 2 | 1 |
| β-strand | 19 | 1 | 2 |
| β-strand | 26 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine protease inhibitor I | A | protein | 35 | O46162 (AlphaFold model) |
>1KGM_1 SERINE PROTEASE INHIBITOR I (chains A) EVTCEPGTTFKDKCNTCRCGSDGKSAACTLKACPQ
Comparative structure analysis of proteinase inhibitors from the desert locust, Schistocerca gregaria. Gaspari, Z., Patthy, A., Graf, L. et al. Eur J Biochem (2002) 269:527-537. DOI 10.1046/j.0014-2956.2001.02685.x · PubMed
Other PDB entries of the same protein (UniProt O46162 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KGM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.