1KIL: Complexin/SNARE complex
Three-dimensional structure of the complexin/SNARE complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Mar 2002.
- Method
- X-ray diffraction
- Resolution
- 2.3 Å
- Organisms
- Rattus norvegicus, Homo sapiens
- Chains
- 5
- Atoms
- 2,610
- Mol. weight
- 36.92 kDa
- Ligands
- MG
- Released
- 13 Mar 2002
Explore 1KIL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1KIL contains 5 α-helices and 0 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-87 | 59 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 193-247 | 55 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-79 | 69 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 141-201 | 61 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-70 | 36 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Synaptobrevin SNARE motif | A | protein | 66 | Rattus norvegicus | P63045 (AlphaFold model) |
| Syntaxin SNARE motif short | B | protein | 62 | Rattus norvegicus | P32851 (AlphaFold model) |
| SNAP-25 N-terminal SNARE motif | C | protein | 74 | Homo sapiens | P60880 (AlphaFold model) |
| SNAP-25 C-terminal SNARE motif | D | protein | 66 | Homo sapiens | P60880 (AlphaFold model) |
| Complexin I SNARE-complex binding region | E | protein | 49 | Rattus norvegicus | P63041 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>1KIL_1 Synaptobrevin SNARE motif (chains A)
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKR
KYWWKN
Sequence of entity 2 (B), FASTA
>1KIL_2 Syntaxin SNARE motif short (chains B)
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
SD
Sequence of entity 3 (C), FASTA
>1KIL_3 SNAP-25 N-terminal SNARE motif (chains C)
GSLEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHIN
QDMKEAEKNLKDLW
Sequence of entity 4 (D), FASTA
>1KIL_4 SNAP-25 C-terminal SNARE motif (chains D)
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQR
ATKMLW
Sequence of entity 5 (E), FASTA
>1KIL_5 Complexin I SNARE-complex binding region (chains E)
GSKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 2 |
Primary citation
Three-dimensional structure of the complexin/SNARE complex. Chen, X., Tomchick, D.R., Kovrigin, E. et al. Neuron (2002) 33:397-409. DOI 10.1016/S0896-6273(02)00583-4 · PubMed
Other PDB entries of the same protein (UniProt P63045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1N7S 1.45 Å, High Resolution Structure of a Truncated Neuronal SNARE Complex
- 5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
- 6WVW 2.11 Å, Crystal structure of the R59P-SNAP25 containing SNARE complex
- 1SFC 2.4 Å, Neuronal synaptic fusion complex
- 5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
- 6A30 2.79 Å, Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region
- 3HD7 3.4 Å, Helical extension of the neuronal snare complex into the membrane, spacegroup C 1 2 1
- 5CCG 3.5 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (long unit cell form)
- 7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
- 5CCH 3.6 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (short unit cell form)
- 6IP1 3.9 Å, alpha-SNAP-SNARE subcomplex in the whole 20S complex
- 5CCI 4.1 Å, Structure of the Mg2+-bound synaptotagmin-1 SNARE complex (short unit cell form)
Browse structure collections
About this viewer
MolViewer shows 1KIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.