1KJM: TAP-A-associated rat MHC class I molecule

TAP-A-associated rat MHC class I molecule. Determined by X-ray diffraction at 2.35 Å resolution. Released 18 Dec 2002.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Rattus norvegicus
Chains: 3
Atoms: 3,298
Mol. weight: 46.13 kDa
Released: 18 Dec 2002

Explore 1KJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KJM contains 10 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-12	11	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-104	11	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	139-149	11
α-helix	152-161	10
α-helix	163-174	12
α-helix	176-179	4
β-strand	183	1	2
α-helix	184-185	2
β-strand	186-193	8	3
β-strand	199-208	10	3
β-strand	209	1	2
β-strand	214-219	6	4
β-strand	222-223	2	4
β-strand	229-230	2	3
β-strand	234-235	2	3
β-strand	241-249	9	3
α-helix	254-256	3
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6	1	6
β-strand	9-11	3	7
β-strand	21-30	10	7
β-strand	31	1	5
β-strand	35-41	7	8
β-strand	44-45	2	8
β-strand	50-51	2	7
β-strand	55-56	2	7
β-strand	62-70	9	7
β-strand	78-84	7	8
β-strand	92-94	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RT1 class I histocompatibility antigen, AA alpha chain, heavy chain	A	protein	285	Rattus norvegicus	P16391 (AlphaFold model)
beta-2-Microglobulin	B	protein	100	Rattus norvegicus	P07151 (AlphaFold model)
B6 Peptide	P	protein	9

Sequence of entity 1 (A), FASTA

>1KJM_1 RT1 class I histocompatibility antigen, AA alpha chain, heavy chain (chains A)
GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYW
EQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDG
RDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLL
RSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGT
FQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEPLLEHHHHHH

Sequence of entity 2 (B), FASTA

>1KJM_2 beta-2-Microglobulin (chains B)
MIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKD
WSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Sequence of entity 3 (P), FASTA

>1KJM_3 B6 Peptide (chains P)
AQFSASASR

Primary citation

Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B. Rudolph, M.G., Stevens, J., Speir, J.A. et al. J Mol Biol (2002) 324:975-990. DOI 10.1016/S0022-2836(02)01095-1 · PubMed

Other PDB entries of the same protein (UniProt P16391 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ED3 2.55 Å, Crystal structure of rat minor histocompatibility antigen complex RT1-aa/mtf-E.
6NF7 2.9 Å, Crystal Structure of RT1.Aa-Bu31-10

Browse structure collections

About this viewer

MolViewer shows 1KJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.