6NF7: RT1.Aa-Bu31-10

Crystal Structure of RT1.Aa-Bu31-10. Determined by X-ray diffraction at 2.9 Å resolution. Released 25 Dec 2019.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Rattus norvegicus
Chains: 15
Atoms: 15,902
Mol. weight: 226.83 kDa
Released: 25 Dec 2019

Explore 6NF7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NF7 contains 54 α-helices and 151 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-161	10
α-helix	163-174	12
α-helix	176-179	4
α-helix	183-185	3
β-strand	186-193	8	2
β-strand	199-208	10	2
β-strand	214-219	6	3
β-strand	222-223	2	3
α-helix	225-227	3
β-strand	229	1	2
β-strand	234-235	2	2
β-strand	241-249	9	2
α-helix	254-256	3
β-strand	258-262	5	3
β-strand	270-273	4	3

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	4
α-helix	4-5	2
β-strand	6-11	6	5
β-strand	21-30	10	5
β-strand	31	1	4
β-strand	36-41	6	6
β-strand	44-45	2	6
α-helix	46	1
β-strand	50-51	2	5
β-strand	55-56	2	5
β-strand	62-70	9	5
β-strand	78-83	6	6
β-strand	91-94	4	6

Chain D: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	7
β-strand	21-28	8	7
β-strand	31-37	7	7
β-strand	46-47	2	7
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	7
β-strand	109-118	10	7
β-strand	121-126	6	7
β-strand	133-135	3	7
α-helix	139-148	10
α-helix	152-158	7
α-helix	159-164	6
α-helix	165-174	10
α-helix	176-179	4
β-strand	183	1	8
α-helix	184-185	2
β-strand	186-193	8	9
β-strand	199-208	10	9
β-strand	209	1	8
β-strand	214-219	6	10
β-strand	222-223	2	10
β-strand	229-230	2	9
α-helix	231-233	3
β-strand	234-235	2	9
β-strand	241-249	9	9
α-helix	254-256	3
β-strand	258-262	5	10
β-strand	272	1	10

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	11
β-strand	6-11	6	12
α-helix	14-15	2
β-strand	21-30	10	12
β-strand	31	1	11
β-strand	36-41	6	13
β-strand	44-45	2	13
α-helix	46	1
β-strand	50	1	12
β-strand	55-56	2	12
β-strand	62-70	9	12
β-strand	78-83	6	13
β-strand	91-94	4	13

Chain G: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	14
α-helix	20	1
β-strand	21-28	8	14
β-strand	31-37	7	14
β-strand	46-47	2	14
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	14
β-strand	109-118	10	14
β-strand	121-126	6	14
β-strand	133-135	3	14
α-helix	138-149	12
α-helix	152-158	7
α-helix	159-163	5
α-helix	164-174	11
β-strand	183	1	15
α-helix	184-185	2
β-strand	186-193	8	16
β-strand	199-208	10	16
β-strand	209	1	15
β-strand	214-219	6	17
β-strand	222-223	2	17
β-strand	228-230	3	16
β-strand	234-235	2	16
β-strand	241-249	9	16
α-helix	254-256	3
β-strand	258-262	5	17
β-strand	270-272	3	17

Chain H: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	18
α-helix	4-5	2
β-strand	6-11	6	19
β-strand	21-30	10	19
β-strand	31	1	18
β-strand	36-41	6	20
β-strand	44-45	2	20
α-helix	46	1
β-strand	50-51	2	19
β-strand	55-56	2	19
β-strand	62-70	9	19
β-strand	78-83	6	20
α-helix	90	1
β-strand	91-94	4	20

Chain J: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	21
α-helix	20	1
β-strand	21-28	8	21
β-strand	31-37	7	21
α-helix	45	1
β-strand	46-47	2	21
α-helix	57-84	28
β-strand	94-103	10	21
β-strand	109-118	10	21
β-strand	121-126	6	21
β-strand	133-135	3	21
α-helix	138-148	11
α-helix	152-158	7
α-helix	159-164	6
α-helix	165-174	10
β-strand	183	1	22
β-strand	186-193	8	23
β-strand	199-208	10	23
β-strand	209	1	22
β-strand	214-218	5	24
β-strand	223	1	24
β-strand	229-230	2	23
β-strand	234-235	2	23
β-strand	241-249	9	23
β-strand	258-262	5	24
β-strand	272-273	2	24

Chain K: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	25
α-helix	4-5	2
β-strand	6	1	26
β-strand	9-11	3	26
β-strand	21	1	27
β-strand	23-30	8	26
β-strand	31	1	25
β-strand	36-41	6	28
β-strand	44-45	2	28
α-helix	46	1
β-strand	50-51	2	26
β-strand	55-56	2	26
β-strand	62-67	6	26
β-strand	70	1	27
β-strand	78-83	6	28
β-strand	91-94	4	28

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RT1A.a	A, D, G, J, M	protein	275	Rattus norvegicus	P16391 (AlphaFold model)
Beta-2-microglobulin	B, E, H, K, N	protein	100	Rattus norvegicus	P07151 (AlphaFold model)
Bu31-10 peptide	C, F, I, L, O	protein	12	Rattus norvegicus	P29826 (AlphaFold model)

Sequence of entity 1 (A, D, G, J, M), FASTA

>6NF7_1 RT1A.a (chains A, D, G, J, M)
GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYW
EQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDG
RDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLL
RSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGT
FQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWE

Sequence of entity 2 (B, E, H, K, N), FASTA

>6NF7_2 Beta-2-microglobulin (chains B, E, H, K, N)
MIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKD
WSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM

Sequence of entity 3 (C, F, I, L, O), FASTA

>6NF7_3 Bu31-10 peptide (chains C, F, I, L, O)
YLRYDSDVGEYR

Primary citation

Cross-Reactive Donor-Specific CD8+Tregs Efficiently Prevent Transplant Rejection. Picarda, E., Bezie, S., Usero, L. et al. Cell Rep (2019) 29:4245-4255.e6. DOI 10.1016/j.celrep.2019.11.106 · PubMed

Other PDB entries of the same protein (UniProt P16391 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KJM 2.35 Å, TAP-A-associated rat MHC class I molecule
1ED3 2.55 Å, Crystal structure of rat minor histocompatibility antigen complex RT1-aa/mtf-E.

Browse structure collections

About this viewer

MolViewer shows 6NF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.