Solution structure of the calmodulin binding domain (CaMBD) of small conductance Ca2+-activated potassium channels (SK2). Determined by solution NMR. Released 14 Dec 2001.
Explore 1KKD in 3D Show helices and sheets RCSB PDB PDBe
1KKD contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 36-39 | 4 | |
| β-strand | 41 | 1 | 1 |
| β-strand | 43 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Small conductance calcium-activated potassium channel protein 2 | A | protein | 102 | Rattus norvegicus | P70604 (AlphaFold model) |
>1KKD_1 Small conductance calcium-activated potassium channel protein 2 (chains A) MGRKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQ RKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHHHHHH
A helical region in the C terminus of small-conductance Ca2+-activated K+ channels controls assembly with apo-calmodulin. Wissmann, R., Bildl, W., Neumann, H. et al. J Biol Chem (2002) 277:4558-4564. DOI 10.1074/jbc.M109240200 · PubMed
Other PDB entries of the same protein (UniProt P70604 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KKD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.