1KSQ: PDB entry 1KSQ

NMR Study of the Third TB Domain from Latent Transforming Growth Factor-beta Binding Protein-1. Determined by solution NMR. Released 26 Aug 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 558
Mol. weight: 8.06 kDa
Released: 26 Aug 2003

Explore 1KSQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KSQ contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	16	1	2
β-strand	23	1	2
β-strand	29-31	3	1
α-helix	32-37	6
β-strand	42-45	4	1
β-strand	48-51	4	1
α-helix	58-63	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Latent transforming growth factor beta binding protein 1	A	protein	75	Homo sapiens	Q14766 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KSQ_1 LATENT TRANSFORMING GROWTH FACTOR BETA BINDING PROTEIN 1 (chains A)
SADQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEF
TEMCPKGKGFVPAGE

Primary citation

Solution Structure of the Third TB Domain from LTBP1 Provides Insight into Assembly of the Large Latent Complex that Sequesters Latent TGF-beta. Lack, J., O'leary, J.M., Knott, V. et al. J Mol Biol (2003) 334:281-291. DOI 10.1016/j.jmb.2003.09.053 · PubMed

Other PDB entries of the same protein (UniProt Q14766 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9R3S 3.06 Å, pro-TGF-beta1 in complex with the third TB Domain from Latent Transforming Growth…

Browse structure collections

About this viewer

MolViewer shows 1KSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.