9R3S: Pro-TGF-beta1

pro-TGF-beta1 in complex with the third TB Domain from Latent Transforming Growth Factor-beta Binding Protein-1. Determined by electron microscopy at 3.06 Å resolution. Released 22 Jul 2026.

Method: Electron microscopy
Resolution: 3.06 Å
Organism: Homo sapiens
Chains: 3
Atoms: 6,003
Mol. weight: 135.1 kDa
Ligands: NAG
Released: 22 Jul 2026

Explore 9R3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9R3S contains 30 α-helices and 43 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	38-56	19
α-helix	62-64	3
α-helix	73-74	2
α-helix	75-85	11
β-strand	106-112	7	6
α-helix	113-115	3
α-helix	120-122	3
β-strand	130-136	7	8
α-helix	137-143	7
α-helix	147-149	3
β-strand	150-160	11	6
β-strand	167-173	7	8
β-strand	179-186	8	8
α-helix	187-189	3
β-strand	194-199	6	6
α-helix	201-210	10
β-strand	214-221	8	8
β-strand	235-236	2	6
β-strand	257-262	6	6
β-strand	280	1	9
α-helix	282-286	5
β-strand	294-296	3	10
α-helix	297	1
β-strand	299	1	11
α-helix	302-306	5
β-strand	311-313	3	2
β-strand	318	1	11
β-strand	321-323	3	10
α-helix	338-340	3
α-helix	354-355	2
β-strand	356-358	3	9
β-strand	361-370	10	2
β-strand	373-384	12	2
β-strand	387-389	3	9

Chain B: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	34	1	1
α-helix	40-56	17
α-helix	72-74	3
α-helix	75-85	11
α-helix	87-88	2
α-helix	100-103	4
β-strand	106-112	7	2
α-helix	113-115	3
β-strand	130-136	7	3
α-helix	137-143	7
β-strand	150-159	10	2
β-strand	162	1	4
β-strand	166-173	8	3
β-strand	179-187	9	3
β-strand	190	1	4
β-strand	194-199	6	2
α-helix	201-210	10
β-strand	214-221	8	3
β-strand	236	1	2
β-strand	257-262	6	2
α-helix	265-268	4
β-strand	290	1	1
β-strand	299-300	2	5
α-helix	302-306	5
β-strand	311-313	3	6
β-strand	317-318	2	5
β-strand	328-329	2	7
α-helix	340-342	3
α-helix	343-346	4
β-strand	356-370	15	6
β-strand	373-389	17	6

Chain C: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	1347	1	12
β-strand	1348-1349	2	7
β-strand	1367	1	12
α-helix	1369-1372	4
β-strand	1380-1381	2	7
β-strand	1385-1386	2	7
α-helix	1388-1391	4
α-helix	1395-1400	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta-1 proprotein	A, B	protein	369	Homo sapiens	P01137 (AlphaFold model)
Latent-transforming growth factor beta-binding protein 1	C	protein	435	Homo sapiens	Q14766 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9R3S_1 Transforming growth factor beta-1 proprotein (chains A, B)
DYKDDDDKLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALY
NSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELR
EAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVT
GVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLM
ATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANF
CLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSN
MIVRSCKCS

Sequence of entity 2 (C), FASTA

>9R3S_2 Latent-transforming growth factor beta-binding protein 1 (chains C)
APLALDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCP
VLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYEC
YCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPA
ESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPLKDS
DDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEELQAEECGILNG
CENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKC
LCLPGYVPSDKPNYCTPLNTALNLEKDSDLTGGGGSGGGGSGGGGSAWSHPQFEKGGGSG
GGSGGSAWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structural basis for the contribution of latent TGF beta binding protein to TGF beta latency and activation. Biggin, G.R., Snee, M., Xiao, Y.B. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-75834-8 · PubMed

Other PDB entries of the same protein (UniProt P01137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UDZ 2.21 Å, The Structure of LTBP-49247 Fab Bound to TGFbeta1 Small Latent Complex
9VJJ 2.48 Å, Crystal Structure of human Latent TGF-beta1 in complex with SOF10
8C7H 2.7 Å, Cryo-EM Map of the latTGF-beta LHG-10 Fab complex
13FJ 2.75 Å, TGFB1 in complex with NIS793 FAB
6OM2 2.77 Å, Crystal structure of atypical integrin alphaV beta8 with proTGF-beta1 ligand peptide
5VQP 2.9 Å, Crystal structure of human pro-TGF-beta1
8REW 2.98 Å, CryoEM structure of human GARP-lTGFbeta1 in complex with a Fab fragment derived from an…
3KFD 3.0 Å, Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor…
4KV5 3.0 Å, scFv GC1009 in complex with TGF-beta1.
8VSC 3.0 Å, L-tgf-b1/GARP
6GFF 3.1 Å, Structure of GARP (LRRC32) in complex with latent TGF-beta1 and MHG-8 Fab
8VSD 3.2 Å, avb8/L-TGF-b1/GARP

Browse structure collections

About this viewer

MolViewer shows 9R3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.