1KZQ: Parasite protein

crystal structure of a parasite protein. Determined by X-ray diffraction at 1.7 Å resolution. Released 31 Jul 2002.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Toxoplasma gondii
Chains: 2
Atoms: 4,375
Mol. weight: 59.66 kDa
Released: 31 Jul 2002

Explore 1KZQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KZQ contains 15 α-helices and 50 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	17-23	7	2
β-strand	24	1	3
β-strand	27	1	3
β-strand	29-33	5	1
α-helix	38	1
β-strand	39-41	3	2
α-helix	43-46	4
β-strand	53	1	4
β-strand	54-55	2	2
β-strand	67	1	4
α-helix	69-71	3
α-helix	78-80	3
β-strand	81-82	2	1
β-strand	93-96	4	1
α-helix	99-101	3
β-strand	107-114	8	2
α-helix	118-120	3
β-strand	122-128	7	2
α-helix	129-133	5
β-strand	134-136	3	5
β-strand	139-141	3	5
β-strand	148-155	8	6
β-strand	162-166	5	5
β-strand	171-174	4	6
β-strand	180-182	3	6
β-strand	192-194	3	6
α-helix	195-197	3
β-strand	207-210	4	5
β-strand	216-220	5	5
β-strand	231-239	9	6
β-strand	244	1	7
β-strand	245-253	9	6

Chain B: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	17-23	7	8
β-strand	24	1	9
β-strand	27	1	9
β-strand	29-33	5	1
β-strand	39-41	3	8
α-helix	43-46	4
β-strand	53	1	10
β-strand	54-55	2	8
β-strand	67	1	10
α-helix	69-71	3
α-helix	78-80	3
β-strand	81-82	2	1
β-strand	93-96	4	1
β-strand	107-114	8	8
α-helix	118-120	3
β-strand	122-128	7	8
α-helix	129-133	5
β-strand	134-136	3	11
β-strand	139-141	3	11
β-strand	147	1	7
β-strand	148-155	8	12
β-strand	162-166	5	11
β-strand	171-174	4	12
β-strand	180-182	3	12
β-strand	192-194	3	12
α-helix	195-197	3
β-strand	207-210	4	11
β-strand	216-220	5	11
α-helix	223-225	3
β-strand	231-239	9	12
β-strand	245-253	9	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Major Surface Antigen P30	A, B	protein	289	Toxoplasma gondii	P13664 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1KZQ_1 Major Surface Antigen P30 (chains A, B)
SDPPLVANQVVTCPDKKSTAAVILTPTENHFTLKCPKTALTEPPTLAYSPNRQICPAGTT
SSCTSKAVTLSSLIPEAEDSWWTGDSASLDTAGIKLTVPIEKFPVTTQTFVVGCIKGDDA
QSCMVTVTVQARASSVVNNVARCSYGADSTLGPVKLSAEGPTTMTLVCGKDGVKVPQDNN
QYCSGTTLTGCNEKSFKDILPKLTENPWQGNASSDKGATLTIKKEAFPAESKSVIIGCTG
GSPEKHHCTVKLEFAGAAGSAKSAAGTASHVSIFAMVIGLIGSIAACVA

Primary citation

Structure of the immunodominant surface antigen from the Toxoplasma gondii SRS superfamily. He, X.L., Grigg, M.E., Boothroyd, J.C. et al. Nat Struct Biol (2002) 9:606-611. PubMed

Other PDB entries of the same protein (UniProt P13664 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YNT 3.1 Å, Structure of the monomeric form of T. gondii SAG1 surface antigen bound to a human Fab

Browse structure collections

About this viewer

MolViewer shows 1KZQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.