1L0I: Butyryl-ACP I62M mutant

Crystal structure of butyryl-ACP I62M mutant. Determined by X-ray diffraction at 1.2 Å resolution. Released 11 Feb 2003.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Escherichia coli
Chains: 1
Atoms: 816
Mol. weight: 9.71 kDa
Ligands: PSR, CAC, ZN
Released: 11 Feb 2003

Explore 1L0I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1L0I contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
α-helix	19-21	3
β-strand	27	1	1
α-helix	36-50	15
α-helix	56-59	4
β-strand	64	1	1
α-helix	65-74	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acyl carrier protein	A	protein	78	Escherichia coli	P0A6A8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1L0I_1 Acyl carrier protein (chains A)
MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA
EKMTTVQAAIDYINGHQA

Ligands and cofactors

ID	Name	Formula	Copies
PSR	Thiobutyric acid S-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-P…	C15 H29 N2 O8 P S	1
CAC	Cacodylate ion	C2 H6 As O2	1
ZN	Zinc ion	Zn	7

Water and common crystallization additives (NA) are not listed.

Primary citation

X-ray Crystallographic Studies on Butyryl-ACP Reveal Flexibility of the Structure around a Putative Acyl Chain Binding Site. Roujeinikova, A., Baldock, C., Simon, W.J. et al. Structure (2002) 10:825-835. DOI 10.1016/S0969-2126(02)00775-X · PubMed

Other PDB entries of the same protein (UniProt P0A6A8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T8K 1.1 Å, Crystal Structure of apo acyl carrier protein from E. coli
9KA6 1.47 Å, Crystal structure of beta-ketoacyl-ACP synthase FabH C112Q in complex with acyl-ACP from…
2FAE 1.55 Å, Crystal structure of E. coli decanoyl-ACP
6OKC 1.55 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
6UXE 1.57 Å, Structure of the human mitochondrial desulfurase complex Nfs1-ISCU2(M140I)-ISD11 with…
2FAD 1.6 Å, Crystal structure of E. coli heptanoyl-ACP
7SQI 1.7 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
2FAC 1.76 Å, Crystal structure of E. coli hexanoyl-ACP
6W1D 1.79 Å, Structure of human mitochondrial complex Nfs1-ISCU2 (WT)-ISD11 with E.coli ACP1 at 1.8 A…
6U0J 1.9 Å, Crosslinked Crystal Structure of Malonyl-CoA Acyl Carrier Protein Transacylase, FabD,…
6WIH 1.9 Å, N-terminal mutation of ISCU2 (L35H36) traps Nfs1 Cys loop in the active site of ISCU2…
4KEH 1.9 Å, Crosslinked Crystal Structure of Type II Fatty Synthase Dehydratase, FabA, and Acyl…

Browse structure collections

About this viewer

MolViewer shows 1L0I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.