Crystal structure of E. coli heptanoyl-ACP. Determined by X-ray diffraction at 1.6 Å resolution. Released 26 Sept 2006.
Explore 2FAD in 3D Show helices and sheets RCSB PDB PDBe
2FAD contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-21 | 3 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 36-49 | 14 | |
| α-helix | 56-61 | 6 | |
| β-strand | 64 | 1 | 1 |
| α-helix | 65-75 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-21 | 3 | |
| β-strand | 27 | 1 | 2 |
| α-helix | 36-50 | 15 | |
| α-helix | 56-59 | 4 | |
| β-strand | 64 | 1 | 2 |
| α-helix | 65-75 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Acyl carrier protein | A, B | protein | 77 | Escherichia coli | P0A6A8 (AlphaFold model) |
>2FAD_1 Acyl carrier protein (chains A, B) STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAE KITTVQAAIDYINGHQA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 8 |
| PM5 | S-(2-{[N-(2-hydroxy-4-{[hydroxy(oxido)phosphino]oxy}-3,3-dimethylbutanoyl)-beta… | C18 H35 N2 O7 P S | 2 |
Water and common crystallization additives (NA) are not listed.
Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates. Roujeinikova, A., Simon, W.J., Gilroy, J. et al. J Mol Biol (2007) 365:135-145. DOI 10.1016/j.jmb.2006.09.049 · PubMed
Other PDB entries of the same protein (UniProt P0A6A8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2FAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.