1LIL: Lambda III bence jones protein cle

Name: PDB 1LIL: Bence jones protein cle, a lambda III immunoglobulin light-chain dimer
Published: 1997-05-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: immunoglobulin

Bence jones protein cle, a lambda III immunoglobulin light-chain dimer. Determined by X-ray diffraction at 2.65 Å resolution. Released 15 May 1997.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,314
Mol. weight: 45.38 kDa
Released: 15 May 1997

Explore 1LIL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LIL contains 10 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	9-13	4	2
α-helix	17-18	2
β-strand	19-23	5	3
β-strand	25	1	1
β-strand	31-38	8	2
β-strand	45-48	4	2
β-strand	49	1	4
β-strand	53	1	4
β-strand	62-67	6	3
β-strand	70-75	6	3
α-helix	80-82	3
β-strand	84-92	9	2
β-strand	95A-98	4	2
β-strand	103-106	4	2
β-strand	111	1	5
α-helix	112-113	2
β-strand	114-118	5	6
α-helix	122-126	5
β-strand	131-139	9	6
β-strand	140	1	5
β-strand	146-150	5	7
β-strand	153-154	2	7
β-strand	165-166	2	6
β-strand	173-180	8	6
α-helix	183-188	6
β-strand	192-197	6	7
β-strand	204-205	2	7
β-strand	208-209	2	7

Chain B: 5 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	8
β-strand	5	1	9
β-strand	9-13	4	8
β-strand	18-24	7	9
α-helix	28-30	3
β-strand	31-38	8	8
β-strand	45-48	4	8
β-strand	49	1	10
β-strand	53	1	10
β-strand	62-66	5	9
β-strand	70-76	7	9
β-strand	84-92	9	8
β-strand	96-99	4	8
β-strand	102-106	5	8
β-strand	111	1	11
β-strand	114-118	5	12
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-137	8	12
β-strand	140	1	11
β-strand	145-150	6	13
β-strand	153-154	2	13
β-strand	159-161	3	12
α-helix	162-164	3
β-strand	165-166	2	14
β-strand	173-174	2	14
β-strand	175-181	7	12
α-helix	183-186	4
β-strand	187	1	15
β-strand	189	1	15
β-strand	192-197	6	13
β-strand	204-209	6	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lambda III bence jones protein cle	A, B	protein	212	Homo sapiens	P0DOY2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LIL_1 LAMBDA III BENCE JONES PROTEIN CLE (chains A, B)
YEVTQPPSLSVSPGQTARITCSGEKLGDAYVCWYQQRPGQSPVVVIYQDNRRPSGIPERF
SGSSSGNTATLTISGTQTLDEADYYCQVWDSNASVVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSL
TPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Pitfalls of molecular replacement: the structure determination of an immunoglobulin light-chain dimer. Huang, D.B., Ainsworth, C., Solomon, A. et al. Acta Crystallogr D Biol Crystallogr (1996) 52:1058-1066. DOI 10.1107/S090744499600813X · PubMed

Other PDB entries of the same protein (UniProt P0DOY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
4LLY 1.6 Å, Crystal structure of Pertuzumab Clambda Fab with variable and constant domain redesigns…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
4LLM 1.75 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
8ECV 1.81 Å, Bovine Fab 2F12
1AQK 1.84 Å, Three-dimensional structure of a human FAB with high affinity for tetanus toxoid
1JVK 1.94 Å, Three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal…
4LLW 1.95 Å, Crystal structure of Pertuzumab Clambda Fab with variable domain redesign (VRD2) at 1.95A
4EOW 1.97 Å, Crystal structure of a disease-associated anti-human GM-CSF autoantibody MB007
7FAB 2.0 Å, Crystal structure of human immunoglobulin fragment FAB new refined at 2.0 Å resolution

Browse structure collections

About this viewer

MolViewer shows 1LIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.