DNA recognition is mediated by conformational transition and by DNA bending. Determined by X-ray diffraction at 2.5 Å resolution. Released 6 Nov 2002.
Explore 1LJM in 3D Show helices and sheets RCSB PDB PDBe
1LJM contains 2 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1062-1064 | 3 | 1 |
| β-strand | 1070-1073 | 4 | 1 |
| β-strand | 1078-1080 | 3 | 2 |
| α-helix | 1083-1085 | 3 | |
| β-strand | 1090-1093 | 4 | 1 |
| β-strand | 1102-1108 | 7 | 3 |
| β-strand | 1117-1118 | 2 | 4 |
| β-strand | 1121-1123 | 3 | 3 |
| β-strand | 1125 | 1 | 1 |
| β-strand | 1128-1130 | 3 | 1 |
| β-strand | 1135-1136 | 2 | 4 |
| β-strand | 1146 | 1 | 5 |
| β-strand | 1147-1152 | 6 | 3 |
| β-strand | 1158-1161 | 4 | 3 |
| β-strand | 1166 | 1 | 5 |
| β-strand | 1167-1169 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2063-2064 | 2 | 6 |
| β-strand | 2065 | 1 | 7 |
| β-strand | 2070-2072 | 3 | 6 |
| β-strand | 2078-2080 | 3 | 8 |
| α-helix | 2083-2085 | 3 | |
| β-strand | 2090-2093 | 4 | 6 |
| β-strand | 2102-2108 | 7 | 9 |
| β-strand | 2118 | 1 | 10 |
| β-strand | 2121-2123 | 3 | 9 |
| β-strand | 2125 | 1 | 6 |
| β-strand | 2128-2130 | 3 | 6 |
| β-strand | 2135 | 1 | 10 |
| β-strand | 2146 | 1 | 11 |
| β-strand | 2147-2152 | 6 | 9 |
| β-strand | 2158-2161 | 4 | 9 |
| β-strand | 2162 | 1 | 7 |
| β-strand | 2166 | 1 | 11 |
| β-strand | 2167-2169 | 3 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RUNX1 transcription factor | A, B | protein | 131 | Homo sapiens | Q01196 (AlphaFold model) |
>1LJM_1 RUNX1 transcription factor (chains A, B) MVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGND ENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITV DGPREPRRHRQ
DNA Recognition by the RUNX1 Transcription Factor Is Mediated by an Allosteric Transition in the RUNT Domain and by DNA Bending. Bartfeld, D., Shimon, L., Couture, G. et al. Structure 10:1395-1407. DOI 10.1016/S0969-2126(02)00853-5 · PubMed
Other PDB entries of the same protein (UniProt Q01196 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.