1H9D: Aml1/cbf-beta/dna complex

Aml1/cbf-beta/dna complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Mar 2001.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 8
Atoms: 4,867
Mol. weight: 73.63 kDa
Released: 31 Mar 2001

Explore 1H9D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H9D contains 12 α-helices and 41 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	62-64	3	1
β-strand	70-73	4	1
β-strand	78-80	3	2
α-helix	83-85	3
β-strand	90-93	4	1
β-strand	102-108	7	3
β-strand	117-118	2	4
β-strand	121-123	3	3
β-strand	124-125	2	1
β-strand	128-130	3	1
α-helix	131	1
β-strand	135-136	2	4
β-strand	146-152	7	3
β-strand	158-166	9	3
β-strand	167-169	3	2

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-14	7
α-helix	16-19	4
β-strand	25-29	5	3
α-helix	37-49	13
β-strand	52-57	6	3
β-strand	62-67	6	3
β-strand	86-87	2	3
β-strand	94-103	10	3
β-strand	106-115	10	3
β-strand	120-127	8	3
α-helix	129-134	6

Chain C: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	62-64	3	5
β-strand	70-73	4	5
β-strand	78-80	3	6
α-helix	83-85	3
β-strand	90-93	4	5
β-strand	102-108	7	7
β-strand	115	1	7
β-strand	117-118	2	8
β-strand	121-123	3	7
β-strand	124-125	2	5
β-strand	128-130	3	5
α-helix	131	1
β-strand	135-136	2	8
β-strand	146-152	7	7
β-strand	158-166	9	7
β-strand	167-169	3	6

Chain D: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-14	7
α-helix	16-22	7
β-strand	25-29	5	7
α-helix	37-49	13
β-strand	52-57	6	7
β-strand	62-67	6	7
β-strand	86-87	2	7
β-strand	94-103	10	7
β-strand	106-115	10	7
β-strand	120-127	8	7
α-helix	129-134	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Core-binding factor alpha SUBUNIT1	A, C	protein	134	HOMO SAPIENS	Q01196 (AlphaFold model)
Core-binding factor cbf-beta	B, D	protein	134	HOMO SAPIENS	Q13951 (AlphaFold model)
DNA (5'-(gptptpgpcpgpgptptpg)-3')	E, G	DNA	10
DNA (5'-(cpapapcpcpgpcpapapc)-3')	F, H	DNA	10

Sequence of entity 1 (A, C), FASTA

>1H9D_1 CORE-BINDING FACTOR ALPHA SUBUNIT1 (chains A, C)
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGN
DENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKIT
VDGPREPRRHRQKL

Sequence of entity 2 (B, D), FASTA

>1H9D_2 CORE-BINDING FACTOR CBF-BETA (chains B, D)
PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATG
TNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDG
MGCLEFDEERAQQE

Sequence of entity 3 (E, G), FASTA

>1H9D_3 DNA (5'-(*GP*TP*TP*GP*CP*GP*GP*TP*TP*G)-3') (chains E, G)
GTTGCGGTTG

Sequence of entity 4 (F, H), FASTA

>1H9D_4 DNA (5'-(*CP*AP*AP*CP*CP*GP*CP*AP*AP*C)-3') (chains F, H)
CAACCGCAAC

Primary citation

The Leukemia-Associated Aml1 (Runx1)-Cbfbeta Complex Functions as a DNA-Induced Molecular Clamp. Bravo, J., Li, Z., Speck, N.A. et al. Nat Struct Biol (2001) 8:371. DOI 10.1038/86264 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1H9D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.