1LM8: HIF-1a-pVHL-ElonginB-ElonginC Complex

Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex. Determined by X-ray diffraction at 1.85 Å resolution. Released 12 Jun 2002.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,406
Mol. weight: 44.98 kDa
Released: 12 Jun 2002

Explore 1LM8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LM8 contains 20 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	10	1	2
β-strand	12-19	8	1
β-strand	23	1	3
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	1
β-strand	49-50	2	1
α-helix	51-52	2
β-strand	56	1	3
β-strand	68	1	4
β-strand	71	1	4
α-helix	72	1
β-strand	73-79	7	1
β-strand	90	1	2
α-helix	98-100	3
α-helix	101-103	3

Chain C: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	1
β-strand	28-32	5	1
α-helix	33-36	4
α-helix	40-45	6
β-strand	59-61	3	1
α-helix	67-83	17
α-helix	89-92	4
α-helix	97-99	3
α-helix	100-110	11

Chain H: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
α-helix	562-564	3
β-strand	565	1	5
β-strand	572-573	2	5

Chain V: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	71-78	8	5
α-helix	83	1
β-strand	84-89	6	6
β-strand	95-97	3	6
β-strand	101	1	6
β-strand	105-112	8	5
β-strand	116-121	6	6
β-strand	127	1	6
β-strand	129-130	2	5
β-strand	133	1	5
β-strand	136	1	6
α-helix	140-141	2
β-strand	142	1	7
β-strand	145	1	7
α-helix	146	1
β-strand	147-152	6	5
α-helix	158-169	12
α-helix	172-177	6
α-helix	182-189	8
α-helix	194-206	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongin B	B	protein	118	Homo sapiens	Q15370 (AlphaFold model)
Elongin C	C	protein	96	Homo sapiens	Q15369 (AlphaFold model)
Von Hippel-Lindau disease tumor suppressor	V	protein	160	Homo sapiens	P40337 (AlphaFold model)
Hypoxia-inducible factor 1 alpha	H	protein	20		Q16665 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1LM8_1 ELONGIN B (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Sequence of entity 2 (C), FASTA

>1LM8_2 ELONGIN C (chains C)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence of entity 3 (V), FASTA

>1LM8_3 Von Hippel-Lindau disease tumor suppressor (chains V)
MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYR
GHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPE
NYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Sequence of entity 4 (H), FASTA

>1LM8_4 Hypoxia-inducible factor 1 alpha (chains H)
DLDLEMLAPYIPMDDDFQLR

Primary citation

Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling. Min, J.H., Yang, H., Ivan, M. et al. Science (2002) 296:1886-1889. DOI 10.1126/science.1073440 · PubMed

Other PDB entries of the same protein (UniProt Q15370 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z76 1.32 Å, Crystal structure of compound 10 in complex with the bromodomain of human SMARCA2 and…
9GIO 1.49 Å, Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of…
7JTO 1.7 Å, Crystal structure of Protac MS33 in complex with the WD repeat-containing protein 5 and…
8BDS 1.72 Å, Ternary complex between VCB, BRD4-BD1 and PROTAC 48
4AJY 1.73 Å, von Hippel-Lindau protein-ElonginB-ElonginC complex, bound to Hif1- alpha peptide
6GMR 1.75 Å, pVHL:EloB:EloC in complex with (4-(1H-pyrrol-1-yl)phenyl)methanol
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
7ZLM 1.79 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound MN551
6I7Q 1.8 Å, Structure of pVHL-elongin B-elongin C (VCB) in complex with hydroxylated-HIF-2alpha…
8BB3 1.8 Å, Structure of human WDR5 and pVHL:ElonginC:ElonginB bound to PROTAC with PEG linker…
6GFX 1.83 Å, pVHL:EloB:EloC in complex with modified HIF-1a CODD peptide containing…
9D1Z 1.88 Å, Structure of G75Q Ubiquitin bound to KLHDC3-EloB/C

Browse structure collections

About this viewer

MolViewer shows 1LM8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.