Structure of pVHL-elongin B-elongin C (VCB) in complex with hydroxylated-HIF-2alpha (523-542) in the C2221 form. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Nov 2019.
Explore 6I7Q in 3D Show helices and sheets RCSB PDB PDBe
6I7Q contains 20 α-helices and 31 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-9 | 8 | 1 |
| β-strand | 10 | 1 | 2 |
| β-strand | 12-19 | 8 | 1 |
| β-strand | 23 | 1 | 3 |
| α-helix | 24-35 | 12 | |
| α-helix | 39-41 | 3 | |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 49-50 | 2 | 1 |
| α-helix | 51-52 | 2 | |
| β-strand | 56 | 1 | 3 |
| β-strand | 68 | 1 | 4 |
| β-strand | 71 | 1 | 4 |
| α-helix | 72 | 1 | |
| β-strand | 73-79 | 7 | 1 |
| β-strand | 80-81 | 2 | 5 |
| β-strand | 84-85 | 2 | 5 |
| α-helix | 86-88 | 3 | |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-94 | 4 | |
| α-helix | 96-100 | 5 | |
| α-helix | 101-103 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-22 | 5 | 1 |
| β-strand | 28-32 | 5 | 1 |
| α-helix | 33-36 | 4 | |
| α-helix | 40-45 | 6 | |
| β-strand | 59-61 | 3 | 1 |
| α-helix | 67-83 | 17 | |
| α-helix | 89-92 | 4 | |
| α-helix | 97-110 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 532 | 1 | 6 |
| β-strand | 540-541 | 2 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 71-78 | 8 | 6 |
| α-helix | 83 | 1 | |
| β-strand | 84-89 | 6 | 7 |
| β-strand | 95-97 | 3 | 7 |
| β-strand | 101 | 1 | 7 |
| β-strand | 105-112 | 8 | 6 |
| β-strand | 116-121 | 6 | 7 |
| β-strand | 127 | 1 | 7 |
| β-strand | 129-130 | 2 | 6 |
| β-strand | 133 | 1 | 6 |
| β-strand | 136 | 1 | 7 |
| α-helix | 140-141 | 2 | |
| β-strand | 142 | 1 | 8 |
| β-strand | 145 | 1 | 8 |
| α-helix | 146 | 1 | |
| β-strand | 147-152 | 6 | 6 |
| α-helix | 158-169 | 12 | |
| α-helix | 172-177 | 6 | |
| α-helix | 183-189 | 7 | |
| α-helix | 194-209 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Elongin-B | B | protein | 118 | Homo sapiens | Q15370 (AlphaFold model) |
| Elongin-C | C | protein | 97 | Bos taurus | Q2KII4 (AlphaFold model) |
| Endothelial PAS domain-containing protein 1 | H | protein | 20 | Homo sapiens | Q99814 (AlphaFold model) |
| von Hippel-Lindau disease tumor suppressor | V | protein | 160 | Homo sapiens | P40337 (AlphaFold model) |
>6I7Q_1 Elongin-B (chains B) MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
>6I7Q_2 Elongin-C (chains C) SMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCM YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
>6I7Q_3 Endothelial PAS domain-containing protein 1 (chains H) ELDLETLAPYIPMDGEDFQC
>6I7Q_4 von Hippel-Lindau disease tumor suppressor (chains V) MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYR GHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPE NYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
HIF-2alpha-pVHL-elongin B-elongin C complex. Chowdhury, R., Schofield, C.J. To be published.
Other PDB entries of the same protein (UniProt Q15370 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.