Solution Structure of Psmalmotoxin 1, the First Characterized Specific Blocker of ASIC1a NA+ channel. Determined by solution NMR. Released 25 Nov 2003.
Explore 1LMM in 3D Show helices and sheets RCSB PDB PDBe
1LMM contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-5 | 2 | |
| β-strand | 9 | 1 | 1 |
| β-strand | 22-25 | 4 | 1 |
| β-strand | 31-34 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Psalmotoxin 1 | A | protein | 40 | Psalmopoeus cambridgei | P60514 (AlphaFold model) |
>1LMM_1 Psalmotoxin 1 (chains A) EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. Escoubas, P., Bernard, C., Lambeau, G. et al. Protein Sci (2003) 12:1332-1343. DOI 10.1110/ps.0307003 · PubMed
Other PDB entries of the same protein (UniProt P60514 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LMM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.