X-ray structure of the H40A/E58A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate. Determined by X-ray diffraction at 1.55 Å resolution. Released 21 Aug 2002.
Explore 1LOY in 3D Show helices and sheets RCSB PDB PDBe
1LOY contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 9-11 | 3 | 1 |
| α-helix | 13-29 | 17 | |
| β-strand | 33 | 1 | 2 |
| β-strand | 38 | 1 | 2 |
| β-strand | 40-42 | 3 | 3 |
| α-helix | 53 | 1 | |
| α-helix | 55 | 1 | |
| β-strand | 56-60 | 5 | 3 |
| β-strand | 61 | 1 | 4 |
| α-helix | 66 | 1 | |
| β-strand | 67 | 1 | 4 |
| α-helix | 68 | 1 | |
| β-strand | 76-81 | 6 | 3 |
| β-strand | 86-91 | 6 | 3 |
| β-strand | 101-102 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Guanyl-specific ribonuclease T1 | A | protein | 104 | Aspergillus oryzae | P00651 (AlphaFold model) |
>1LOY_1 Guanyl-specific ribonuclease T1 (chains A) ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPAKYNNYEGFDFSVSSPYYAWP ILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study. Mignon, P., Steyaert, J., Loris, R. et al. J Biol Chem (2002) 277:36770-36774. DOI 10.1074/jbc.M206461200 · PubMed
Other PDB entries of the same protein (UniProt P00651 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LOY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.