1RGA: Ribonuclease T1

Crystal structure of RNase T1 with 3'-GMP and guanosine: a product complex. Determined by X-ray diffraction at 1.7 Å resolution. Released 31 Oct 1993.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Aspergillus oryzae
Chains: 1
Atoms: 979
Mol. weight: 11.78 kDa
Ligands: CA, 3GP, GMP
Released: 31 Oct 1993

Explore 1RGA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RGA contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	9-11	3	1
α-helix	13-29	17
β-strand	33	1	2
β-strand	38	1	2
β-strand	40-42	3	3
α-helix	53	1
α-helix	55	1
β-strand	56-61	6	3
α-helix	66-68	3
β-strand	76-81	6	3
β-strand	86-91	6	3
β-strand	101-102	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribonuclease T1	A	protein	104	Aspergillus oryzae	P00651 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RGA_1 RIBONUCLEASE T1 (chains A)
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWP
ILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
3GP	Guanosine-3'-monophosphate	C10 H14 N5 O8 P	1
GMP	Guanosine	C10 H13 N5 O5	1

Primary citation

Crystal structure of RNase T1 with 3'-guanylic acid and guanosine. Zegers, I., Haikal, A.F., Palmer, R. et al. J Biol Chem (1994) 269:127-133. PubMed

Other PDB entries of the same protein (UniProt P00651 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1I0V 1.23 Å, Ribonuclease T1 in complex with 2'GMP (form I crystal)
4ODK 1.4 Å, Structure of SlyD from Thermus thermophilus in complex with T1 peptide
9RNT 1.5 Å, Ribonuclease T1 with free recognition and catalytic site: crystal structure analysis at…
1LOV 1.55 Å, X-ray structure of the E58A mutant of Ribonuclease T1 complexed with 3'-guanosine…
1LOY 1.55 Å, X-ray structure of the H40A/E58A mutant of Ribonuclease T1 complexed with 3'-guanosine…
1I0X 1.65 Å, Ribonuclease T1 in complex with 2'GMP (form II crystal)
4GSP 1.65 Å, Ribonuclease T1 complexed with 2',3'-cgps + 3'-GMP, 7 days
1HYF 1.7 Å, Ribonuclease T1 V16A mutant in complex with SR2+
1Q9E 1.7 Å, RNase T1 variant with adenine specificity
4BIR 1.7 Å, Ribonuclease T1: free HIS92GLN mutant
1I3I 1.76 Å, Ribonuclease T1 V78T mutant
3BU4 1.77 Å, Ribonuclease T1 complex with 2'GMP

Browse structure collections

About this viewer

MolViewer shows 1RGA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.