Insecticidal alpha scorpion toxin isolated from the venom of scorpion leiurus quinquestriatus hebraeus, NMR, 29 structures. Determined by solution NMR. Released 12 Mar 1997.
Explore 1LQI in 3D Show helices and sheets RCSB PDB PDBe
1LQI contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| β-strand | 7 | 1 | 2 |
| β-strand | 8 | 1 | 3 |
| β-strand | 14 | 1 | 3 |
| α-helix | 20-30 | 11 | |
| β-strand | 34-39 | 6 | 1 |
| β-strand | 45-53 | 9 | 1 |
| β-strand | 58 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Insect toxin alpha | A | protein | 65 | Leiurus quinquestriatus hebraeus | P17728 (AlphaFold model) |
>1LQI_1 INSECT TOXIN ALPHA (chains A) MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRV PGKCR
Solution structures of a highly insecticidal recombinant scorpion alpha-toxin and a mutant with increased activity. Tugarinov, V., Kustanovich, I., Zilberberg, N. et al. Biochemistry (1997) 36:2414-2424. DOI 10.1021/bi961497l · PubMed
Other PDB entries of the same protein (UniProt P17728 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.