Crystal structure of the B subunit of human heat-labile enterotoxin from E. Coli carrying a peptide with anti-hsv activity. Determined by X-ray diffraction at 3.04 Å resolution. Released 9 Feb 1999.
Explore 1LTR in 3D Show helices and sheets RCSB PDB PDBe
1LTR contains 21 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-77 | 18 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-52 | 2 | |
| α-helix | 61-77 | 17 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-77 | 17 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-61 | 3 | |
| α-helix | 62-77 | 16 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat-labile enterotoxin | D, E, F, G, H | protein | 113 | Escherichia coli | P0CK94 (AlphaFold model) |
>1LTR_1 HEAT-LABILE ENTEROTOXIN (chains D, E, F, G, H) APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDS QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEKLYAGAVVNDL
Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity. Matkovic-Calogovic, D., Loregian, A., D'Acunto, M.R. et al. J Biol Chem (1999) 274:8764-8769. PubMed
Other PDB entries of the same protein (UniProt P0CK94 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.