1M18: Histone H3.2
Ligand binding alters the structure and dynamics of nucleosomal DNA. Determined by X-ray diffraction at 2.45 Å resolution. Released 18 Feb 2003.
- Method
- X-ray diffraction
- Resolution
- 2.45 Å
- Organism
- Xenopus laevis
- Chains
- 10
- Atoms
- 12,676
- Mol. weight
- 201.95 kDa
- Ligands
- 1SZ, MN
- Released
- 18 Feb 2003
Explore 1M18 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1M18 contains 38 α-helices and 20 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 441-442 | 2 | |
| α-helix | 445-456 | 12 | |
| α-helix | 464-476 | 13 | |
| β-strand | 483-484 | 2 | 1 |
| α-helix | 486-513 | 28 | |
| β-strand | 518-519 | 2 | 2 |
| α-helix | 521-531 | 11 | |
Chain B: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 3 |
Chain C: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 817-821 | 5 | |
| α-helix | 827-836 | 10 | |
| β-strand | 842-843 | 2 | 4 |
| α-helix | 846-872 | 27 | |
| β-strand | 877-878 | 2 | 5 |
| α-helix | 880-888 | 9 | |
| α-helix | 891-896 | 6 | |
| β-strand | 900-902 | 3 | 6 |
| α-helix | 913-915 | 3 | |
Chain D: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1235-1245 | 11 | |
| β-strand | 1250-1251 | 2 | 5 |
| α-helix | 1253-1280 | 28 | |
| β-strand | 1285-1286 | 2 | 4 |
| α-helix | 1288-1298 | 11 | |
| α-helix | 1301-1320 | 20 | |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 641-642 | 2 | |
| α-helix | 645-656 | 12 | |
| α-helix | 664-676 | 13 | |
| β-strand | 683-684 | 2 | 7 |
| α-helix | 686-713 | 28 | |
| β-strand | 718-719 | 2 | 8 |
| α-helix | 721-731 | 11 | |
Chain F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 225-228 | 4 | |
| α-helix | 231-240 | 10 | |
| β-strand | 245-246 | 2 | 8 |
| α-helix | 250-275 | 26 | |
| β-strand | 280-281 | 2 | 7 |
| α-helix | 283-292 | 10 | |
| β-strand | 296-298 | 3 | 6 |
Chain G: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1017-1021 | 5 | |
| α-helix | 1027-1036 | 10 | |
| β-strand | 1042-1043 | 2 | 9 |
| α-helix | 1047-1072 | 26 | |
| β-strand | 1077-1078 | 2 | 10 |
| α-helix | 1080-1088 | 9 | |
| α-helix | 1091-1096 | 6 | |
| β-strand | 1100-1102 | 3 | 3 |
| α-helix | 1113-1115 | 3 | |
Chain H: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1435-1445 | 11 | |
| β-strand | 1450-1451 | 2 | 10 |
| α-helix | 1453-1480 | 28 | |
| β-strand | 1485-1486 | 2 | 9 |
| α-helix | 1488-1498 | 11 | |
| α-helix | 1501-1519 | 19 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Palindromic 146 Base Pair DNA Fragment | I, J | DNA | 146 | | |
| Histone H3.2 | A, E | protein | 135 | Xenopus laevis | P02302 (AlphaFold model) |
| Histone H4 | B, F | protein | 102 | Xenopus laevis | P62799 (AlphaFold model) |
| Histone H2A.1 | C, G | protein | 129 | Xenopus laevis | P06897 (AlphaFold model) |
| Histone H2B.1 | D, H | protein | 125 | Xenopus laevis | P02281 (AlphaFold model) |
Sequence of entity 1 (I, J), FASTA
>1M18_1 Palindromic 146 Base Pair DNA Fragment (chains I, J)
ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGC
ATGTTCAGCGGAATTCCGCTGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTT
GGTAGAATCTGCAGGTGGATATTGAT
Sequence of entity 2 (A, E), FASTA
>1M18_2 Histone H3.2 (chains A, E)
ARTKQTARKSTGGKAPRKQLVTKAAKKCAPATGGVKKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
Sequence of entity 3 (B, F), FASTA
>1M18_3 Histone H4 (chains B, F)
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 4 (C, G), FASTA
>1M18_4 Histone H2A.1 (chains C, G)
SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
ESAKSAKSK
Sequence of entity 5 (D, H), FASTA
>1M18_5 Histone H2B.1 (chains D, H)
PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMS
IMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSAK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| 1SZ | N-[5-[[4-[[5-[[5-[[5-[[5-[[3-[3-(dimethylamino)propylamino]-3-oxidanylidene-pro… | C58 H71 N21 O10 | 2 |
| MN | Manganese (II) ion | Mn | 11 |
Primary citation
Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands. Suto, R.K., Edayathumangalam, R.S., White, C.L. et al. J Mol Biol (2003) 326:371-380. DOI 10.1016/S0022-2836(02)01407-9 · PubMed
Other PDB entries of the same protein (UniProt P02302 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1M19 2.3 Å, Ligand binding alters the structure and dynamics of nucleosomal DNA
- 6YN1 2.35 Å, Crystal structure of histone chaperone APLF acidic domain bound to the histone…
- 1M1A 2.65 Å, Ligand binding alters the structure and dynamics of nucleosomal DNA
- 1AOI 2.8 Å, Complex between nucleosome core particle (H3,H4,H2A,H2B) and 146 bp long DNA fragment
- 8TOF 2.8 Å, Rpd3S bound to an H3K36Cme3 modified nucleosome
- 8ETV 3.16 Å, Class2 of the INO80-Hexasome complex
- 8U5H 3.23 Å, Cryo-EM structure of human DNMT3A UDR bound to H2AK119ub1-modified nucleosome
- 6PX1 3.3 Å, Set2 bound to nucleosome
- 8DU4 3.55 Å, Complex between RbBP5-WDR5 and an H2B-ubiquitinated nucleosome
- 7M1X 3.7 Å, Cryo-EM Structure of Nucleosome containing mouse histone variant H2A.Z
- 6NZO 3.8 Å, Set2 bound to nucleosome
- 6PX3 4.1 Å, Set2 bound to nucleosome
Browse structure collections
About this viewer
MolViewer shows 1M18 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.