1M1E: Beta-catenin armadillo repeat domain

Beta-catenin armadillo repeat domain bound to ICAT. Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Oct 2002.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 4,708
Mol. weight: 68.03 kDa
Released: 16 Oct 2002

Explore 1M1E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M1E contains 41 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	152-161	10
α-helix	165-178	14
α-helix	182-189	8
α-helix	192-202	11
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-243	8
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-347	14
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-388	14
α-helix	389-391	3
α-helix	399-408	10
α-helix	414-427	14
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	491-496	6
α-helix	504-517	14
α-helix	521-523	3
α-helix	524-529	6
α-helix	532-548	17
β-strand	560-561	2	1
β-strand	564-565	2	1
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-602	7
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-643	7
α-helix	649-662	14

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	11-28	18
α-helix	31-34	4
α-helix	35-43	9
α-helix	45-52	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-catenin	A	protein	538	Mus musculus	Q02248 (AlphaFold model)
Icat	B	protein	81	Homo sapiens	Q9NSA3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M1E_1 Beta-catenin (chains A)
HAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQ
MVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLF
YAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKL
IILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP
SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYK
NKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPV
VVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSM
GGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRV
AAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYK

Sequence of entity 2 (B), FASTA

>1M1E_2 ICAT (chains B)
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ

Primary citation

ICAT inhibits Beta-catenin binding to Tcf/Lef-family transcription factors and the general coactivator p300 using independent structural modules. Daniels, D.L., Weis, W.I. Mol Cell (2002) 10:573-584. DOI 10.1016/S1097-2765(02)00631-7 · PubMed

Other PDB entries of the same protein (UniProt Q02248 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DOW 1.8 Å, Crystal structure of a chimera of beta-catenin and alpha-catenin
4EV8 1.9 Å, Crystal structure of mouse catenin beta-59 in 2.4M urea.
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
4EVA 2.0 Å, Crystal Structure of Mouse Catenin beta-59 in 5.6M urea
1V18 2.1 Å, The crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated…
3BCT 2.1 Å, The armadillo repeat region from murine beta-catenin
4EV9 2.1 Å, Crystal Structure of Mouse Catenin beta-59 in 4.0M urea
4EVP 2.25 Å, Crystal Structure of Mouse Catenin beta-59 in 7.2M urea
4EVT 2.34 Å, Crystal Structure of Mouse Catenin beta-59 in 8.3M urea
3OUX 2.4 Å, Structure of beta-catenin with phosphorylated Lef-1
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…
2BCT 2.9 Å, The armadillo repeat region from murine beta-catenin

Browse structure collections

About this viewer

MolViewer shows 1M1E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.