1M2N: Silent Information Regulator 2

Sir2 homologues (D102G/F159A/R170A) mutant-2'-O-acetyl ADP ribose complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 8 Apr 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Archaeoglobus fulgidus
Chains: 2
Atoms: 4,088
Mol. weight: 56.2 kDa
Ligands: ZN, OAD
Released: 8 Apr 2003

Explore 1M2N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M2N contains 31 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	15-19	5	1
α-helix	21-23	3
α-helix	25-27	3
α-helix	35-37	3
β-strand	39	1	2
β-strand	42	1	2
α-helix	44-46	3
α-helix	50-55	6
α-helix	57-71	15
α-helix	78-88	11
β-strand	92-97	6	1
α-helix	103-107	5
β-strand	112-114	3	1
β-strand	117-124	8	3
β-strand	130-132	3	3
α-helix	136-138	3
α-helix	142-143	2
β-strand	152-156	5	3
α-helix	162-164	3
α-helix	167-175	9
β-strand	180-184	5	1
α-helix	193-195	3
α-helix	196-201	6
β-strand	206-210	5	1
α-helix	218-220	3
β-strand	223-225	3	1
α-helix	229-243	15

Chain B: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	15-19	5	4
α-helix	21-27	7
α-helix	35-37	3
β-strand	39	1	5
β-strand	42	1	5
α-helix	44-46	3
α-helix	52-55	4
α-helix	57-71	15
α-helix	78-88	11
β-strand	92-97	6	4
α-helix	105-107	3
β-strand	112-114	3	4
β-strand	117-124	8	6
β-strand	130-132	3	6
α-helix	142-143	2
β-strand	144	1	7
β-strand	151	1	7
β-strand	152-156	5	6
α-helix	157-158	2
α-helix	165-177	13
β-strand	180-184	5	4
α-helix	195-202	8
β-strand	206-210	5	4
α-helix	218-220	3
β-strand	223-225	3	4
α-helix	229-243	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Silent Information Regulator 2	A, B	protein	249	Archaeoglobus fulgidus	O28597 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1M2N_1 Silent Information Regulator 2 (chains A, B)
MDEKLLKTIAESKYLVALTGAGVSAESGIPTFRGKDGLWNRYRPEELANPQAFAKDPEKV
WKWYAWRMEKVFNAQPNKAHQAFAELERLGVLKCLITQNVDGLHERAGSRNVIHLHGSLR
VVRCTSCNNSFEVESAPKIPPLPKCDKCGSLLRPGVVWAGEMLPPDVLDAAMREVERADV
IIVAGTSAVVQPAASLPLIVKQRGGAIIEINPDETPLTPIADYSLRGKAGEVMDELVRHV
RKALSLKLN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
OAD	2'-O-acetyl adenosine-5-diphosphoribose	C17 H25 N5 O15 P2	2

Primary citation

Structural basis for the NAD-dependent deacetylase mechanism of Sir2. Chang, J.H., Kim, H.C., Hwang, K.Y. et al. J Biol Chem (2003) 277:34489-34498. DOI 10.1074/jbc.M205460200 · PubMed

Other PDB entries of the same protein (UniProt O28597 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1M2K 1.47 Å, Sir2 homologue F159A mutant-ADP ribose complex
1M2G 1.7 Å, Sir2 homologue-ADP ribose complex
1M2J 1.7 Å, Sir2 homologue H80N mutant-ADP ribose complex
4TWI 1.79 Å, The structure of Sir2Af1 bound to a succinylated histone peptide
1M2H 1.8 Å, Sir2 homologue S24A mutant-ADP ribose complex
1ICI 2.1 Å, Crystal structure of a SIR2 homolog-NAD complex

Browse structure collections

About this viewer

MolViewer shows 1M2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.