1M31: Apo-Mts1

Three-Dimensional Solution Structure of Apo-Mts1. Determined by solution NMR. Released 30 Oct 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,638
Mol. weight: 23.49 kDa
Released: 30 Oct 2002

Explore 1M31 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M31 contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-23	20
β-strand	29-30	2	1
α-helix	31-41	11
α-helix	44-47	4
α-helix	52-62	11
β-strand	69-70	2	1
α-helix	72-85	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Placental calcium-binding protein	A, B	protein	101	Homo sapiens	P26447 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1M31_1 Placental calcium-binding protein (chains A, B)
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Primary citation

Solution structure of human Mts1 (S100A4) as determined by NMR spectroscopy. Vallely, K.M., Rustandi, R.R., Ellis, K.C. et al. Biochemistry (2002) 41:12670-12680. DOI 10.1021/bi020365r · PubMed

Other PDB entries of the same protein (UniProt P26447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CFQ 1.37 Å, Ca-bound truncated (delta13C) and C3S, C81S and C86S mutated S100A4 complexed with…
4CFR 1.4 Å, Ca-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with non- muscle myosin IIA
3C1V 1.5 Å, The 1.5 A Crystal structure of Ca2+-bound S100A4
4ETO 1.54 Å, Structure of S100A4 in complex with non-muscle myosin-IIA peptide
2Q91 1.63 Å, Structure of the Ca2+-Bound Activated Form of the S100A4 Metastasis Factor
27UH 1.82 Å, Crystal structure of a de novo-designed VHH targeting S100A4
7PSQ 1.91 Å, Crystal structure of S100A4 labeled with NU074381b.
3ZWH 1.94 Å, Ca2+-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with myosin IIA
3CGA 2.03 Å, Crystal structure of metastasis-associated protein S100A4 in the active, calcium-bound…
5LPU 2.1 Å, Crystal structure of Annexin A2 complexed with S100A4
4HSZ 2.25 Å, Structure of truncated (delta8C) S100A4
3KO0 2.3 Å, Structure of the tfp-ca2+-bound activated form of the s100a4 Metastasis factor

Browse structure collections

About this viewer

MolViewer shows 1M31 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.