1M9A: Glutathione S-Transferase 26 kDa

Name: PDB 1M9A: Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with S-hexylglutathione
Published: 2003-03-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with S-hexylglutathione. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 Mar 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Schistosoma japonicum
Chains: 1
Atoms: 1,981
Mol. weight: 25.93 kDa
Ligands: GTX
Released: 4 Mar 2003

Explore 1M9A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M9A contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
α-helix	15-24	10
β-strand	29-33	5	1
α-helix	34	1
α-helix	38-45	8
β-strand	57-59	3	1
β-strand	64-66	3	1
α-helix	68-77	10
α-helix	86-107	22
α-helix	115-136	22
β-strand	142	1	2
β-strand	145	1	2
α-helix	150-165	16
α-helix	174-184	11
α-helix	187-193	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutathione S-Transferase 26 kDa	A	protein	218	Schistosoma japonicum	P08515 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M9A_1 Glutathione S-Transferase 26 kDa (chains A)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID
GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKV
DFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFK
KRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Ligands and cofactors

ID	Name	Formula	Copies
GTX	S-hexylglutathione	C16 H30 N3 O6 S	1

Primary citation

Characterization of the electrophile binding site and substrate binding mode of the 26-kDa glutathione S-transferase from Schistosoma japonicum. Cardoso, R.M.F., Daniels, D.S., Bruns, C.M. et al. Proteins (2003) 51:137-146. DOI 10.1002/prot.10345 · PubMed

Other PDB entries of the same protein (UniProt P08515 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OK1 1.38 Å, WD repeat containing protein 5 (WDR5)- N225A mutant
6JI6 1.5 Å, Crystal structure of glutathione S-transferase complexed and modified with glutathione
6RWD 1.53 Å, Crystal structure of SjGST in complex with GSH and ellagic acid at 1.53 Angstrom…
4WR4 1.6 Å, Crystal Structure of GST Mutated with Halogenated Tyrosine (7bGST-1)
9NME 1.6 Å, SARS-CoV-2 3CLPro in complex with 2-[2-hydroxy-3-(4-isoquinolyl)-4-oxo-6-(trifluoromethyl…
8GYD 1.7 Å, Structure of Schistosoma japonicum Glutathione S-transferase bound with the ligand…
9N4U 1.77 Å, Crystal structure of PAK1 bound to compound R1
1DUG 1.8 Å, Structure of the fibrinogen G chain integrin binding and factor xiiia crosslinking sites…
9NMF 1.8 Å, SARS-CoV-2 3CLPro in complex with 8-(6-amino-3-pyridyl)-2-hydroxy-3-(4-isoquinolyl)-6-(tr…
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
8OKF 1.85 Å, WD repeat containing protein 5 (WDR5)- PER2 peptide
9N48 1.85 Å, Crystal structure of PAK1 bound to compound C1

Browse structure collections

About this viewer

MolViewer shows 1M9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.