9N48: PAK1

Crystal structure of PAK1 bound to compound C1. Determined by X-ray diffraction at 1.85 Å resolution. Released 25 Jun 2025.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,976
Mol. weight: 123.65 kDa
Ligands: A1BV1
Released: 25 Jun 2025

Explore 9N48 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9N48 contains 42 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	250-259	10
β-strand	262-263	2	1
α-helix	266-269	4
β-strand	270-279	10	1
β-strand	282-289	8	1
β-strand	295-302	8	1
α-helix	303-305	3
α-helix	309-321	13
β-strand	327	1	2
β-strand	330-336	7	1
β-strand	339-345	7	1
β-strand	351	1	2
α-helix	352-358	7
α-helix	360-362	3
α-helix	363-382	20
β-strand	385-386	2	3
α-helix	392-394	3
β-strand	395-397	3	2
β-strand	403-405	3	2
α-helix	408-410	3
β-strand	412-413	2	3
β-strand	415	1	4
β-strand	418	1	4
β-strand	421	1	5
α-helix	428-430	3
α-helix	433-436	4
β-strand	441	1	5
α-helix	444-459	16
α-helix	469-479	11
α-helix	482-484	3
α-helix	487-489	3
α-helix	492-501	10
α-helix	510-511	2
α-helix	512-515	4
α-helix	519-523	5
α-helix	524-526	3
α-helix	527-530	4
α-helix	531-543	13

Chain B: 20 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	256-260	5
α-helix	266-269	4
β-strand	270-279	10	6
β-strand	282-289	8	6
β-strand	295-302	8	6
α-helix	309-321	13
β-strand	327	1	7
α-helix	328-329	2
β-strand	330-335	6	6
β-strand	339-345	7	6
β-strand	351	1	7
α-helix	352-358	7
α-helix	363-382	20
α-helix	392-394	3
β-strand	395-397	3	7
β-strand	403-405	3	7
α-helix	423-424	2
α-helix	433-436	4
α-helix	444-459	16
α-helix	469-479	11
α-helix	482-484	3
α-helix	487-489	3
α-helix	492-501	10
α-helix	510-511	2
α-helix	512-515	4
α-helix	519-523	5
α-helix	524-526	3
α-helix	527-530	4
α-helix	531-541	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutathione S-transferase class-mu 26 kDa isozyme,Serine/threonine-protein kinase PAK 1	A, B	protein	537	Homo sapiens	P08515 (AlphaFold model), Q13153 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9N48_1 Glutathione S-transferase class-mu 26 kDa isozyme,Serine/threonine-protein kinase PAK 1 (chains A, B)
MHHHHHHHHGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLE
FPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAY
SKDFETLKVDFLSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLD
AFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGENLYFQGSDE
EILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKEL
IINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCR
ECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSEMVGTPYWM
APEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLS
AIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNHGNS

Ligands and cofactors

ID	Name	Formula	Copies
A1BV1	(6M)-8-[2-(2-aminoethoxy)ethyl]-6-[2-chloro-3-fluoro-4-(2-oxopyrrolidin-1-yl)ph…	C23 H26 Cl F N6 O3	2

Primary citation

Integrating Hydrogen Exchange with Molecular Dynamics for Improved Ligand Binding Predictions. Walters, B.T., Patapoff, A.W., Kiefer, J.R. et al. J Chem Inf Model (2025) 65:6144-6154. DOI 10.1021/acs.jcim.5c00397 · PubMed

Other PDB entries of the same protein (UniProt P08515 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OK1 1.38 Å, WD repeat containing protein 5 (WDR5)- N225A mutant
6JI6 1.5 Å, Crystal structure of glutathione S-transferase complexed and modified with glutathione
6RWD 1.53 Å, Crystal structure of SjGST in complex with GSH and ellagic acid at 1.53 Angstrom…
4WR4 1.6 Å, Crystal Structure of GST Mutated with Halogenated Tyrosine (7bGST-1)
9NME 1.6 Å, SARS-CoV-2 3CLPro in complex with 2-[2-hydroxy-3-(4-isoquinolyl)-4-oxo-6-(trifluoromethyl…
8GYD 1.7 Å, Structure of Schistosoma japonicum Glutathione S-transferase bound with the ligand…
9N4U 1.77 Å, Crystal structure of PAK1 bound to compound R1
1DUG 1.8 Å, Structure of the fibrinogen G chain integrin binding and factor xiiia crosslinking sites…
9NMF 1.8 Å, SARS-CoV-2 3CLPro in complex with 8-(6-amino-3-pyridyl)-2-hydroxy-3-(4-isoquinolyl)-6-(tr…
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
8OKF 1.85 Å, WD repeat containing protein 5 (WDR5)- PER2 peptide
3CRT 1.9 Å, Structural characterization of an engineered allosteric protein

Browse structure collections

About this viewer

MolViewer shows 9N48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.