1MAK: Isolated antibody vl domain

Solution structure of an isolated antibody vl domain. Determined by solution NMR. Released 31 Jan 1994.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 864
Mol. weight: 12.29 kDa
Released: 31 Jan 1994

Explore 1MAK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MAK contains 1 α-helix and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
β-strand	10	1	2
β-strand	13	1	3
β-strand	19-24	6	1
β-strand	30	1	4
β-strand	36	1	4
β-strand	38-43	6	2
β-strand	50	1	2
β-strand	53-55	3	5
β-strand	58-59	2	5
β-strand	67-70	4	1
β-strand	75-80	6	1
β-strand	89-95	7	2
α-helix	101-102	2
β-strand	103-109	7	2
β-strand	111	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG2A-kappa 26-10 fv (light chain)	A	protein	113	Mus musculus	P01631 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MAK_1 IGG2A-KAPPA 26-10 FV (LIGHT CHAIN) (chains A)
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR

Primary citation

Solution structure of an isolated antibody VL domain. Constantine, K.L., Friedrichs, M.S., Metzler, W.J. et al. J Mol Biol (1994) 236:310-327. DOI 10.1006/jmbi.1994.1137 · PubMed

Other PDB entries of the same protein (UniProt P01631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DLF 1.45 Å, High resolution crystal structure of the fv fragment from an anti-dansyl switch variant…
2DLF 1.55 Å, High resolution crystal structure of the fv fragment from an anti-dansyl switch variant…
1N4X 1.7 Å, Structure of scFv 1696 at acidic pH
1WZ1 1.85 Å, Crystal structure of the Fv fragment complexed with dansyl-lysine
1SVZ 1.89 Å, Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope…
2IPT 2.0 Å, PFA1 Fab Fragment
2IQA 2.0 Å, PFA2 FAB fragment, monoclinic apo form
2HKF 2.01 Å, Crystal structure of the Complex Fab M75- Peptide
2O5X 2.05 Å, Crystal structure of 1E9 LeuH47Trp/ArgH100Trp, an engineered Diels-Alderase Fab with nM…
1BFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
1CFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
2HKH 2.1 Å, Crystal structure of the Fab M75

Browse structure collections

About this viewer

MolViewer shows 1MAK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.