1MAM: IGG2B-kappa YST9.1 FAB

Crystal structure to 2.45 a resolution of a monoclonal FAB specific for the brucella a cell wall polysaccharide antigen. Determined by X-ray diffraction at 2.45 Å resolution. Released 31 Oct 1993.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,296
Mol. weight: 46.93 kDa
Released: 31 Oct 1993

Explore 1MAM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MAM contains 13 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	2
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	56	1	7
β-strand	58	1	7
β-strand	60-62	3	2
β-strand	70-75	6	6
β-strand	80-85	6	6
α-helix	90-92	3
β-strand	94-100	7	2
β-strand	108-109	2	2
β-strand	113-117	5	2
α-helix	121-122	2
β-strand	123	1	8
α-helix	124-125	2
β-strand	126-130	5	9
β-strand	142-151	10	9
β-strand	152	1	8
β-strand	157-159	3	10
β-strand	170-177	8	9
β-strand	180-189	10	9
β-strand	200-205	6	10
β-strand	209-214	6	10

Chain L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	44-49	6	2
α-helix	50-52	3
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
α-helix	107	1
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	144-150	7	5
β-strand	153-155	3	5
β-strand	159-163	5	4
β-strand	173-182	10	4
α-helix	183-187	5
β-strand	192-198	7	5
β-strand	205-209	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG2B-kappa YST9.1 FAB (light chain)	L	protein	214	Mus musculus
IGG2B-kappa YST9.1 FAB (heavy chain)	H	protein	217	Mus musculus	P01867 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1MAM_1 IGG2B-KAPPA YST9.1 FAB (LIGHT CHAIN) (chains L)
DIQMTQTTSSLSASLGDRVTISCRASQDIYNYLNWYQQKPDGTVKLLIYYTSRLHSGVPS
RFSGSGSGTDYSLTISNLNQEDMATYICQQGNTLPFTFGSGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1MAM_2 IGG2B-KAPPA YST9.1 FAB (HEAVY CHAIN) (chains H)
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKADGYTT
EYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCTRDPYGPAAYWGQGTLVTVSAA
KTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGL
YTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE

Primary citation

Crystal structure to 2.45 A resolution of a monoclonal Fab specific for the Brucella A cell wall polysaccharide antigen. Rose, D.R., Przybylska, M., To, R.J. et al. Protein Sci (1993) 2:1106-1113. PubMed

Other PDB entries of the same protein (UniProt P01867 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YNL 1.7 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
1OSP 1.95 Å, Crystal structure of outer surface protein A of borrelia burgdorferi complexed with a…
1NBV 2.0 Å, An autoantibody to single-stranded DNA: comparison of the three-dimensional structures…
1UB5 2.0 Å, Crystal structure of Antibody 19G2 with hapten at 100K
1YNK 2.1 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
1UB6 2.12 Å, Crystal structure of Antibody 19G2 with sera ligand
2RGS 2.13 Å, FC-fragment of monoclonal antibody IGG2B from Mus musculus
2Q8B 2.3 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
6KRU 2.3 Å, Crystal structure of mouse IgG2b Fc
2Q8A 2.4 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
1FL3 2.45 Å, Crystal structure of the blue fluorescent antibody (19G2) in complex with stilbene…
2GK0 2.45 Å, Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2

Browse structure collections

About this viewer

MolViewer shows 1MAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.