1MBN: The stereochemistry of the protein myoglobin

The stereochemistry of the protein myoglobin. Determined by X-ray diffraction at 2.0 Å resolution. Released 19 May 1976.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Physeter catodon
Chains: 1
Atoms: 1,260
Mol. weight: 17.87 kDa
Ligands: OH, HEM
Released: 19 May 1976

Explore 1MBN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MBN contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	21-35	15
α-helix	37-41	5
α-helix	44-47	4
α-helix	52-57	6
α-helix	59-76	18
α-helix	83-92	10
α-helix	93-97	5
α-helix	101-118	18
α-helix	125-149	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myoglobin	A	protein	153	Physeter catodon	P02185 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MBN_1 MYOGLOBIN (chains A)
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASED
LKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP
GDFGADAQGAMNKALELFRKDIAAKYKELGYQG

Ligands and cofactors

ID	Name	Formula	Copies
OH	Hydroxide ion	H O	1
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1

Primary citation

The Stereochemistry of the Protein Myoglobin. Watson, H.C. Prog Stereochem (1969) 4:299. PubMed

Other PDB entries of the same protein (UniProt P02185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YCE 0.77 Å, Sperm whale myoglobin swMb
7VDN 0.93 Å, High resolution crystal structure of Sperm Whale Myoglobin in the carbonmonoxy form
1A6M 1.0 Å, Oxy-myoglobin, atomic resolution
1NAZ 1.04 Å, structure of microgravity-grown oxidized myoglobin mutant YQR (ISS8A)
8ESU 1.04 Å, Myoglobin variant Mb-imi complex
1A6K 1.1 Å, Aquomet-myoglobin, atomic resolution
2EKT 1.1 Å, Crystal structure of myoglobin reconstituted with 6-methyl-6-depropionatehemin
3O89 1.1 Å, Crystal Structure of Sperm Whale Myoglobin G65T
6M8F 1.1 Å, Engineered sperm whale myoglobin-based carbene transferase
9P1F 1.1 Å, Myoglobin variant RR22 in complex with imidazole
4H07 1.14 Å, Complex of G65T Myoglobin with Phenol in its Proximal Cavity
1A6G 1.15 Å, Carbonmonoxy-myoglobin, atomic resolution

Browse more

1MBN is part of these collections:

About this viewer

MolViewer shows 1MBN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.